iTeh StandardsiTeh Standards
EURUSD
Your shopping cart is empty.
CEN

CEN/TS 15747:2008

(Main)

Solid recovered fuels - 14C-based methods for the determination of the biomass content

Solid recovered fuels - 14C-based methods for the determination of the biomass content

This Technical Specification specifies the test methods for the determination of the biomass carbon content in solid recovered fuels based on the 14C content. The biomass fraction by weight and by energy are calculated from the biomass carbon content.

Feste Sekundärbrennstoffe - 14C-Verfahren zur Bestimmung des Gehaltes an Biomasse

Diese Technische Spezifikation legt die Prüfverfahren zur Bestimmung des Kohlenstoffgehaltes von Biomasse
in festen Sekundärbrennstoffen auf der Grundlage des 14C-Gehaltes fest. Der Massenanteil an Biomasse und
der Biomasse-Energieanteil werden aus dem Massenanteil an Kohlenstoff der Biomasse berechnet.

Combustibles solides de récupération - Méthodes basées sur le 14C pour la détermination de la teneur en biomasse

Trdno alternativno gorivo - Metode za določevanje vsebnosti biomase na osnovi izotopa ogljika 14C

General Information

Status
Withdrawn
Publication Date
28-Oct-2008
Withdrawal Date
08-Mar-2011
ICS
75.160.10 - Solid fuels
75.160.40 - Biofuels
Technical Committee
CEN/TC 343 - Solid Recovered Fuels
Drafting Committee
CEN/TC 343/WG 3 - Sampling, sample reduction and supplementary test methods
Current Stage
9960 - Withdrawal effective - Withdrawal
Start Date
09-Mar-2011
Completion Date
09-Mar-2011
Ref Project
SIST-TS CEN/TS 15747:2009 - Solid recovered fuels - 14C-based methods for the determination of the biomass content

Relations

Replaced By
EN 15440:2011 - Solid recovered fuels - Methods for the determination of biomass content
Effective Date
12-Mar-2011

Buy Standard

TS CEN/TS 15747:2009TS CEN/TS 15747:2009
PreviousNext
Technical specification
TS CEN/TS 15747:2009
English language
26 pages
sale 10% off
Preview
sale 10% off
Preview
e-Library read for
1 day

Standards Content (Sample)

SLOVENSKI STANDARD
SIST-TS CEN/TS 15747:2009
01-januar-2009
7UGQRDOWHUQDWLYQRJRULYR0HWRGH]DGRORþHYDQMHYVHEQRVWLELRPDVHQDRVQRYL
L]RWRSDRJOMLND&
Solid recovered fuels - 14C-based methods for the determination of the biomass content
Feste Sekundärbrennstoffe - 14C-Verfahren zur Bestimmung des Gehaltes an Biomasse
Combustibles solides de récupération - Méthodes basées sur le 14C pour la
détermination de la teneur en biomasse
Ta slovenski standard je istoveten z: CEN/TS 15747:2008
ICS:
75.160.10 Trda goriva Solid fuels
SIST-TS CEN/TS 15747:2009 en,de
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.

---------------------- Page: 1 ----------------------

SIST-TS CEN/TS 15747:2009

---------------------- Page: 2 ----------------------

SIST-TS CEN/TS 15747:2009


TECHNICAL SPECIFICATION
CEN/TS 15747

SPÉCIFICATION TECHNIQUE

TECHNISCHE SPEZIFIKATION
October 2008
ICS 75.160.10
English Version
14
Solid recovered fuels - C-based methods for the determination
of the biomass content
14
Combustibles solides de récupération - Méthodes basées Feste Sekundärbrennstoffe - C-Verfahren zur
14
sur le C pour la détermination de la teneur en biomasse Bestimmung des Gehaltes an Biomasse
This Technical Specification (CEN/TS) was approved by CEN on 11 May 2008 for provisional application.

The period of validity of this CEN/TS is limited initially to three years. After two years the members of CEN will be requested to submit their
comments, particularly on the question whether the CEN/TS can be converted into a European Standard.

CEN members are required to announce the existence of this CEN/TS in the same way as for an EN and to make the CEN/TS available
promptly at national level in an appropriate form. It is permissible to keep conflicting national standards in force (in parallel to the CEN/TS)
until the final decision about the possible conversion of the CEN/TS into an EN is reached.

CEN members are the national standards bodies of Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland,
France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, Netherlands, Norway, Poland, Portugal,
Romania, Slovakia, Slovenia, Spain, Sweden, Switzerland and United Kingdom.






EUROPEAN COMMITTEE FOR STANDARDIZATION
COMITÉ EUROPÉEN DE NORMALISATION

EUROPÄISCHES KOMITEE FÜR NORMUNG

Management Centre: rue de Stassart, 36  B-1050 Brussels
© 2008 CEN All rights of exploitation in any form and by any means reserved Ref. No. CEN/TS 15747:2008: E
worldwide for CEN national Members.

---------------------- Page: 3 ----------------------

SIST-TS CEN/TS 15747:2009
CEN/TS 15747:2008 (E)
Contents Page
Foreword.3
Introduction .4
1 Scope .5
2 Normative references .5
3 Terms and definitions .5
4 Symbols and abbreviations .5
5 Equipment and reagents.6
6 Principle.7
7 Procedure .7
8 Measurements.8
9 Calculation.9
10 Test report .11
14
Annex A (normative) C Determination by Proportional Scintillation-counter Method (PSM).12
14
Annex B (normative) C Determination by Beta-ionisation (BI) .16
14
Annex C (normative) C Determination by Accelerator Mass Spectromet
...

Questions, Comments and Discussion

Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.

This May Also Interest You

CEN
EN 15410:2011(Main)
Solid recovered fuels - Methods for the determination of the content of major elements (Al, Ca, Fe, K, Mg, Na, P, Si, Ti)
SIST EN 15410:2011

This European Standard specifies three methods of digestion for solid recovered fuels:
a)   microwave assisted digestion with hydrofluoric, nitric and hydrochloric acid mixture;
b)   hot water bath digestion of with hydrofluoric, nitric and hydrochloric acid mixture, after ashing of the SRFs sample;
c)   oven digestion with nitric, perchloric and hydrofluoric acid mixture.
Instrumental determination of Si, Al, K, Na, Ca, Mg, Fe, P, and Ti is performed by Inductively Coupled Plasma Spectrometry with optical detection or other suitable spectroscopic techniques such as Flame Atomic Spectroscopy.
The effectiveness of the digestion can be verified by qualitative X-ray fluorescence (XRF) analysis on the remaining residue. If necessary an alternative digestion method (among those proposed) shall be used.
XRF can be used for the analysis of Si, Al, K, Na, Ca, Mg, Fe, P, Ti, after ashing (550 °C) of the sample: other elements can be analysed by XRF provided that the concentration levels are above the instrumental detection limits of the XRF instrumentation and after proper preliminary testing.
Method a) is recommended for general use, but the amount of the test portion can be very low in case of high concentration of organic matter. Method b) is recommended for SRFs with high organic matter concentration that can be difficult to digest with the other methods.
Method c) is recommended for SRFs samples for which the other methods leave a significant insoluble residue.
All the listed methods are suitable for the determination of Si, provided that closed containers are used for sample dissolution. XRF is highly recommended for Si, P and Ti analysis.
Alternative digestion methods can be applied if their performance is proved to be comparable with those of the methods mentioned in a) to c) (see Annex C).

  • Standard
    27 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
EN 15411:2011(Main)
Solid recovered fuels - Methods for the determination of the content of trace elements (As, Ba, Be, Cd, Co, Cr, Cu, Hg, Mo, Mn, Ni, Pb, Sb, Se, Tl, V and Zn)
SIST EN 15411:2011

This European Standard specifies three methods of digestion for solid recovered fuels:
a) microwave assisted digestion with hydrofluoric, nitric and hydrochloric acid mixture;
b) hot water bath digestion of with hydrofluoric, nitric and hydrochloric acid mixture, after ashing of the SRFs
sample;
c) oven digestion with nitric, perchloric and hydrofluoric acid mixture.
Instrumental determination of As, Ba, Be, Cd, Cr, Co, Cu, Pb, Mn, Mo, Ni, Sb, Se, Tl, V, Zn is performed by
Inductively Coupled Plasma with optical or mass detection or graphite furnace Atomic Absorption
Spectrometry. Hg can be analysed only after the microwave assisted procedure or, alternatively, by a direct
analysis method (Hg direct  AMA).
The effectiveness of the digestion can be verified by qualitative X-ray fluorescence (XRF) analysis on the
remaining residue. If necessary, an alternative digestion method (among those proposed) is used.
Method a) is recommended for general use, but the amount of the test portion can be very low in case of high
concentration of organic matter.
Method b) is recommended for Solid Recovered Fuel (SRF) with high organic matter concentration that can
be difficult to digest with the other methods. This method is not suitable for mercury.
Method c) is recommended for Solid Recovered Fuel (SRF) samples for which the other methods leave a
significant insoluble residue.
Alternative digestion methods can be applied if their performance is proved to be comparable with those of the
methods mentioned in a) to c) (see Annex C).

  • Standard
    25 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
EN 15415-1:2011(Main)
Solid recovered fuels - Determination of particle size distribution - Part 1: Screen method for small dimension particles
SIST EN 15415-1:2011

This European Standard specifies the determination of particle size distribution of solid recovered fuels by a
machine or manual sieving method. It applies to particulate agglomerated and non-agglomerated fuels, such
as fluff, pellets, briquettes, pulverised solid recovered fuels.
This sieving method is not applicable to large pieces with irregular shape such as the pieces of shredded tyres
or of demolition wood. In the case, of large pieces of irregular shape, prEN 15415-2 and prEN 15415-3 are
applicable.
NOTE 1 For fine particles < 1 mm (e.g. sludges), the use of other methods could give more representative results as
e.g. an analysis with the laser diffraction method in accordance with ISO 13320.
NOTE 2 This European Standard is based on EN 15149-1 applicable to particle sizes less than 3,15 mm.

  • Standard
    11 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
EN 15358:2011(Main)
Solid recovered fuels - Quality management systems - Particular requirements for their application to the production of solid recovered fuels
SIST EN 15358:2011

This European Standard specifies requirements for the quality management system for the production and trade of solid recovered fuels from the reception of waste(s) up to the delivery of solid recovered fuels
(Figure 1).
Figure 1 - Quality management systems within the solid recovered fuels chain

  • Standard
    40 pages
    English language
    sale 10% off
    e-Library read for
    1 day
  • Standard – translation
    36 pages
    Slovenian language
    sale 10% off
    e-Library read for
    1 day
CEN
EN 15408:2011(Main)
Solid recovered fuels - Methods for the determination of sulphur (S), chlorine (Cl), fluorine (F) and bromine (Br) content
SIST EN 15408:2011

This European Standard specifies the determination of S, Cl, F and Br in solid recovered fuels of various origin and composition after combustion in oxygen atmosphere. This method is applicable for concentrations over 0,025 g/kg, depending on the element and on the determination technique. In the case of fluorine this method is applicable for concentration over 0,015 g/kg.
Insoluble halides and sulphate present in the original sample or produced during the combustion step are not completely determined by these methods.
This European Standard provides recommendations concerning standardised methods for determination of halides and sulphate in the solution obtained after combustion.

  • Standard
    18 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
CEN/TS 15406:2010(Main)
Solid recovered fuels - Determination of bridging properties of bulk material
SIST-TS CEN/TS 15406:2010

This Technical Specification specifies a method for the determination of bridging properties of solid recovered fuels using standard measuring equipment. The method is applicable to all solid recovered fuels with maximum dimensions of the particle of 100 mm.

  • Technical specification
    13 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
CEN/TR 15404:2010(Main)
Solid recovered fuels - Methods for the determination of ash melting behaviour by using characteristic temperatures
SIST-TP CEN/TR 15404:2010

This Technical Report describes exemplarily methods for the determination of shrinking, deformation, hemisphere and flow temperature for characterising the ash melting behaviour of all solid recovered fuels.

  • Technical report
    17 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
CEN/TS 15639:2010(Main)
Solid recovered fuels - Determination of mechanical durability of pellets
SIST-TS CEN/TS 15639:2010

This document specifies a test method for the determination of mechanical durability of pellets. It is intended to be applied by persons and organisations that manufacture, plan, sell, erect or use machinery, equipment, tools and entire plants related to such pellets, and that are involved in producing, purchasing, selling and utilising pellets.
The method specified is not applicable to soft pellets.

  • Technical specification
    9 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
CEN/TS 15405:2010(Main)
Solid recovered fuels - Determination of density of pellets and briquettes
SIST-TS CEN/TS 15405:2010

This Technical Specification specifies a method for the determination of particle density of irregularly shaped pieces of compressed fuels such as pellets or briquettes. It is not applicable to soft or semi-soft pellets.
NOTE 1   The term soft pellet is defined in CEN/TS 15639.
NOTE 2   Particle density is subject to variation due to the susceptibility of organic material to environmental or technical impacts such as air humidity, vibration, abrasion or biodegradation. Therefore, particle density can vary during time thus the measured values should be regarded as a momentary fuel property.
NOTE 3   At the time of preparing this document, the production of briquettes of solid recovered fuels could not be identified in the European market.

  • Technical specification
    14 pages
    English language
    sale 10% off
    e-Library read for
    1 day
CEN
CEN/TS 15414-1:2010(Main)
Solid recovered fuels - Determination of moisture content using the oven dry method - Part 1: Determination of total moisture by a reference method
SIST-TS CEN/TS 15414-1:2010

This Technical Specification specifies a method for the determination of total moisture content of solid recovered fuels by drying a sample in an oven. This method is suitable for use if a high precision of the determination of moisture content is required. It is applicable to all solid recovered fuels.
NOTE 1   The total moisture content of solid recovered fuels is not an absolute value and therefore standardised conditions for its determination are indispensable to enable comparative determinations.
NOTE 2   The term moisture content when used with recovered materials can be misleading since solid recovered materials, e.g. biomass, frequently contains varying amounts of volatile compounds (extractives) which can evaporate when determining moisture content by oven drying.
NOTE 3   This Technical Specification is based on EN 14774 1 [1].

  • Technical specification
    8 pages
    English language
    sale 10% off
    e-Library read for
    1 day