ISO 710-6:1984
(Main)Graphical symbols for use on detailed maps, plans and geological cross-sections — Part 6: Representation of contact rocks and rocks which have undergone metasomatic, pneumatolytic or hydrothermal transformation or transformation by weathering
Graphical symbols for use on detailed maps, plans and geological cross-sections — Part 6: Representation of contact rocks and rocks which have undergone metasomatic, pneumatolytic or hydrothermal transformation or transformation by weathering
Provides a series of graphical symbols to represent rocks which have originated as the result of contact metamorphism or other effects. The symbols are divided into four groups which are shown in the table: a) contact rocks; b) metasomatic transformation; c) pneumatolytic and hydrothermal processes; d) weathering processes.
Symboles graphiques à utiliser sur les cartes, les plans et les coupes géologiques détaillés — Partie 6: Représentation des roches de contact et des roches ayant subi une transformation métasomatique, pneumatolytique ou hydrothermale ou une transformation par altération
Grafične oznake na detajlnih kartah, tlorisih in na geoloških prerezih - 6. del: Prikaz kontaktnih kamnin in kamnin, ki so bile metasomatsko, pnevmatolitsko ali hidrotermalno spremenjene ter spremenjene zaradi preperevanja
General Information
Standards Content (Sample)
SLOVENSKI STANDARD
01-november-1995
*UDILþQHR]QDNHQDGHWDMOQLKNDUWDKWORULVLKLQQDJHRORãNLKSUHUH]LKGHO
3ULND]NRQWDNWQLKNDPQLQLQNDPQLQNLVRELOHPHWDVRPDWVNRSQHYPDWROLWVNRDOL
KLGURWHUPDOQRVSUHPHQMHQHWHUVSUHPHQMHQH]DUDGLSUHSHUHYDQMD
Graphical symbols for use on detailed maps, plans and geological cross-sections -- Part
6: Representation of contact rocks and rocks which have undergone metasomatic,
pneumatolytic or hydrothermal transformation or transformation by weathering
Symboles graphiques à utiliser sur les cartes, les plans et les coupes géologiques
détaillés -- Partie 6: Représentation des roches de contact et des roches ayant subi une
transformation métasomatique, pneumatolytique ou hydrothermale ou une
transformation par altération
Ta slovenski standard je istoveten z: ISO 710-6:1984
ICS:
01.080.30 *UDILþQLVLPEROL]DXSRUDERY Graphical symbols for use on
ULVEDKGLDJUDPLKQDþUWLK mechanical engineering and
]HPOMHYLGLKYVWURMQLãWYXLQ construction drawings,
JUDGEHQLãWYXWHUYXVWUH]QL diagrams, plans, maps and in
WHKQLþQLSURL]YRGQL relevant technical product
GRNXPHQWDFLML documentation
07.060 Geologija. Meteorologija. Geology. Meteorology.
Hidrologija Hydrology
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
~-_ -- ---~
International Standard 710/6
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.MEXAYHAPOHAR OPfAHbl3AL&lR IlO CTAH~APTt43AWl1M~ORGANISATION INTERNATIONALE DE NORMALISATION
Graphical symbols for use on detailed maps, plans and
geological cross-sections -
Part 6 : Representation of contact rocks and rocks which
have undergone metasomatic, pneumatolytic or
hydrothermal transformation or transformation by
weathering
Symboles graphiques 9 utiliser sur /es cartes, /es plans et /es coupes g6ologiques d&ail/& - Partie 6 : RepAentation des roches
de contact et des roches ayant subi une transformation m&tasomatique, pneumatolytique ou hydrothermafe ou une
transformation par a&&a tion
First edition - 1984-06-01
UDC 528.94 : 553.22/.23 : 003.62
Ref. No. IS0 710/6-1984 (E)
Descriptors : geology, maps, drawings, transverse sections, schematic representation,
symbols, graphic symbols, rocks.
Price based on 4 pages
Foreword
IS0 (the International Organization for Standardization) is a worldwide federation of
national standards bodies (IS0 member bodies). The work of developing International
Standards is carried out through IS0 technical committees. Every member body
interested in a subject for which a technical committee has been authorized has the
right to be represented on that committee. International organizations, governmental
and non-governmental, in liaison with ISO, also take part in the work.
Draft International Standards adopted by the technical committees are circulated to
the member bodies for approval before their acceptance as International Standards by
the IS0 Council.
International Standard IS0 710/6 was developed by Technical Committee ISO/TC 82,
Mining, and was circulated to the member bodies in October 1983.
It has been approved by the member bodies of the following countries :
Australia
Czechoslovakia Romania
Austria France United Kingdom
Bulgaria
Germany, F. R. Yugoslavia
China Poland
No member body expressed disapproval of the document.
0 International Organization for Standardization, 1984
Printed in Switzerland
IS0 710/6-1984 (E)
INTERNATIONAL STANDARD
Graphical symbols for use on detailed maps, plans and
geological cross-sections -
Part 6 : Representation of contact rocks and rocks which
have undergone metasomatic, pneumatolytic or
hydrothermal transformation or transformation by
weathering
0 Introduction 2 General
The rocks dealt with in this part of IS0 710 are formed either by
IS0 710, a series of documents on graphical symbols for use on
isochemical processes (in which case they are pure contact
detailed maps, plans and geological cross-sections, comprises
rocks) or allochemical processes, i.e. transformation processes
the following parts :
with allochthone material which generally also take place within
the aureole of a magmatic intrusion.
Part 1 : General rules of representation.
In general, these rocks owe their existence to pneumatolytic or
Part 2 : Representation of sedimentary rocks.
hydrothermal processes with allochthone material but there are
also some rocks formed by molecular diffusion at elevated
Part 3 : Representation of magmatic rocks.
temperatures and by autohydration. These processes may
result in a greater or lesser degree of transformation which is
Part 4 : Representation of metamorphic rocks.
reflected in the rock.
Part 5 : Representation of minerals.
Occasionally, the transformation processes have produced
rocks which are identical to those of the metamorphic facies;
Part 6 : Representation of contact rocks and rocks which
the hydrothermal sericitisation of a volcanic rock, for example,
have undergone metasomatic,
...
~-_ -- ---~
International Standard 710/6
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.MEXAYHAPOHAR OPfAHbl3AL&lR IlO CTAH~APTt43AWl1M~ORGANISATION INTERNATIONALE DE NORMALISATION
Graphical symbols for use on detailed maps, plans and
geological cross-sections -
Part 6 : Representation of contact rocks and rocks which
have undergone metasomatic, pneumatolytic or
hydrothermal transformation or transformation by
weathering
Symboles graphiques 9 utiliser sur /es cartes, /es plans et /es coupes g6ologiques d&ail/& - Partie 6 : RepAentation des roches
de contact et des roches ayant subi une transformation m&tasomatique, pneumatolytique ou hydrothermafe ou une
transformation par a&&a tion
First edition - 1984-06-01
UDC 528.94 : 553.22/.23 : 003.62
Ref. No. IS0 710/6-1984 (E)
Descriptors : geology, maps, drawings, transverse sections, schematic representation,
symbols, graphic symbols, rocks.
Price based on 4 pages
Foreword
IS0 (the International Organization for Standardization) is a worldwide federation of
national standards bodies (IS0 member bodies). The work of developing International
Standards is carried out through IS0 technical committees. Every member body
interested in a subject for which a technical committee has been authorized has the
right to be represented on that committee. International organizations, governmental
and non-governmental, in liaison with ISO, also take part in the work.
Draft International Standards adopted by the technical committees are circulated to
the member bodies for approval before their acceptance as International Standards by
the IS0 Council.
International Standard IS0 710/6 was developed by Technical Committee ISO/TC 82,
Mining, and was circulated to the member bodies in October 1983.
It has been approved by the member bodies of the following countries :
Australia
Czechoslovakia Romania
Austria France United Kingdom
Bulgaria
Germany, F. R. Yugoslavia
China Poland
No member body expressed disapproval of the document.
0 International Organization for Standardization, 1984
Printed in Switzerland
IS0 710/6-1984 (E)
INTERNATIONAL STANDARD
Graphical symbols for use on detailed maps, plans and
geological cross-sections -
Part 6 : Representation of contact rocks and rocks which
have undergone metasomatic, pneumatolytic or
hydrothermal transformation or transformation by
weathering
0 Introduction 2 General
The rocks dealt with in this part of IS0 710 are formed either by
IS0 710, a series of documents on graphical symbols for use on
isochemical processes (in which case they are pure contact
detailed maps, plans and geological cross-sections, comprises
rocks) or allochemical processes, i.e. transformation processes
the following parts :
with allochthone material which generally also take place within
the aureole of a magmatic intrusion.
Part 1 : General rules of representation.
In general, these rocks owe their existence to pneumatolytic or
Part 2 : Representation of sedimentary rocks.
hydrothermal processes with allochthone material but there are
also some rocks formed by molecular diffusion at elevated
Part 3 : Representation of magmatic rocks.
temperatures and by autohydration. These processes may
result in a greater or lesser degree of transformation which is
Part 4 : Representation of metamorphic rocks.
reflected in the rock.
Part 5 : Representation of minerals.
Occasionally, the transformation processes have produced
rocks which are identical to those of the metamorphic facies;
Part 6 : Representation of contact rocks and rocks which
the hydrothermal sericitisation of a volcanic rock, for example,
have undergone metasomatic, pneumatolytic or hydrother-
may lead to the formation of a sericitic schist. In such a case, it
mal transformation or transformation by weathering.
is considered advisable to use the symbol for the metamorphic
rock, particularly when no residue of the original volcanic rock
Part 7 : Tectonic symbols.
remains.
3 Principles of representation (see the table)
1 Scope and field of application
3.1 General
This part of IS0 710 provides a series of graphical symbols to
represent on a map, plan or geological cross-section, rocks
Basically, the symbols serve to represent the rocks formed by
which have originated as the result of contact metamorphism,
the various transformation processes. They are not intended
of metasomatic, pneumatolytic or hydrothermal transformation
for characterization or interpretation of genetic processes.
or
...
.
Norme internationale 710/6
INTERNATIONAL ORGANIZATION FOR STANDARDIZATlON.ME>)(LLYHAPO~HAFl OPfAHM3ALU4R fl0 CTAHAAPTbI3A~blkWORGANISATION INTERNATIONALE DE NORMALISATION
Symboles graphiques à utiliser sur les cartes, les plans et
les coupes géologiques détaillés -
Partie 6 : Représentation des roches de contact et des
roches ayant subi une transformation métasomatique,
pneumatolytique ou hydrothermale ou une transformation
par altération
Graphical symbols for use on detailed maps, plans and geological cross-sections - Part 6 : Representation of contact rocks and
rocks which bave undergone metasomatic, pneuma tolytic or h ydro thermal transformation or transformation b y wea tbering
Première édition - 1984-06-01
CDU 528.94 : 553.22/.23 : 003.62
Réf n no : ISO 710/6-1984 (F)
Descripteurs : géologie, carte géographique, dessin, coupe transversale, représentation schématique, symbole, symbole graphique, roche.
Prix basé sur 4 pages
Avant-propos
L’ISO (Organisation internationale de normalisation) est une fédération mondiale
d’organismes nationaux de normalisation (comités membres de I’ISO). L’élaboration
des Normes internationales est confiée aux comités techniques de I’ISO. Chaque
comité membre intéressé par une étude a le droit de faire partie du comité technique
correspondant. Les organisations internationales, gouvernementales et non gouverne-
mentales, en liaison avec I’ISO, participent également aux travaux.
Les projets de Normes internationales adoptés par les comités techniques sont soumis
aux comités membres pour approbation, avant leur acceptation comme Normes inter-
nationales par le Conseil de I’ISO.
La Norme internationale ISO 710/6 a été élaborée par le comité technique ISO/TC 82,
Exploitation minière, et a été soumise aux comités membres en octobre 1983.
Les comités membres des pays suivants l’ont approuvée :
Chine Royaume-Uni
Allemagne, R. F.
Australie France Tchécoslovaquie
Yougoslavie
Autriche Pologne
Bulgarie Roumanie
Aucun comité membre ne l’a désapprouvée.
@ Organisation internationale de normalisation, 1984 l
Imprimé en Suisse
ISO 710/6-1984 (F)
NORME INTERNATIONALE
Symboles graphiques à utiliser sur les cartes, les plans et
les coupes géologiques détaillés -
Partie 6 : Représentation des roches de contact et des
roches ayant subi une transformation métasomatique,
pneumatolytique ou hydrothermale ou une transformation
par altération
2 Généralités
0 Introduction
La genèse des roches traitées dans la présente partie de
L’ISO 710, série de documents consacrés aux symboles graphi-
I’ISO 710 résulte soit de phénomènes isochimiques (auquel cas
ques à utiliser sur les cartes, les plans et les coupes géologiques
il s’agit de roches de contact pur), soit de phénomènes allochi-
détaillés, comprend les parties suivantes :
miques, c’est-à-dire de processus de transformation mettant en
jeu un matériau allochtone et qui se produit aussi, en règle
Partie 1 : Règles générales de représentation.
générale, dans l’auréole d’une masse magmatique intrusive.
Partie 2 : Représentation des roches sédimentaires.
Ces roches doivent, en général, leur existence à des phénomè-
nes pneumatolytiques ou hydrothermaux mettant en jeu des
Partie 3 : Représentation des roches magmatiques.
matériaux allochtones, mais certaines se forment aussi par dif-
fusion moléculaire à température élevée et par autohydratation.
Partie 4 : Représentation des roches métamorphiques.
Ces phénomènes entraînent une transformation plus ou moins
marquée que reflète la roche elle-même.
Partie 5 : Représentation des minéraux.
De temps en temps, les phénomènes de transformation don-
Partie 6 : Représentation des roches de contact et des
nent naissance à des roches de faciès identique à celui des
roches ayant subi une transformation métasomatique,
roches métamorphiques. Ainsi, la séricitisation hydrothermale
pneumatolytique ou hydrothermale ou une transformation
d’une roche volcanique peut-elle conduire à la formation d’un
par altération.
schiste séricitique. Dans ce cas, il est conseillé de reprendre le
symbole de la roche métamorphique, notamment s’il ne sub-
Partie 7 : Symboles tectoniques.
siste rien de la roche volcanique d’origine.
3 Principes de représentation (voir le tableau)
1 Objet et domaine d’application
3.1 Généralités
La présente partie de I’ISO 710 établit une série de symboles
graphiques pour la représentation, sur une carte, un plan ou
Les symboles servent fondamentalement à représenter les
une coupe géologique, des roches dont la formation résulte
roches formées selon les divers processus de transformation.
d’un métamorphisme de contact, d’une transformation méta-
Ils ne cherchent ni à caractériser, ni à interpréter les processus
somatique,
...
.
Norme internationale 710/6
INTERNATIONAL ORGANIZATION FOR STANDARDIZATlON.ME>)(LLYHAPO~HAFl OPfAHM3ALU4R fl0 CTAHAAPTbI3A~blkWORGANISATION INTERNATIONALE DE NORMALISATION
Symboles graphiques à utiliser sur les cartes, les plans et
les coupes géologiques détaillés -
Partie 6 : Représentation des roches de contact et des
roches ayant subi une transformation métasomatique,
pneumatolytique ou hydrothermale ou une transformation
par altération
Graphical symbols for use on detailed maps, plans and geological cross-sections - Part 6 : Representation of contact rocks and
rocks which bave undergone metasomatic, pneuma tolytic or h ydro thermal transformation or transformation b y wea tbering
Première édition - 1984-06-01
CDU 528.94 : 553.22/.23 : 003.62
Réf n no : ISO 710/6-1984 (F)
Descripteurs : géologie, carte géographique, dessin, coupe transversale, représentation schématique, symbole, symbole graphique, roche.
Prix basé sur 4 pages
Avant-propos
L’ISO (Organisation internationale de normalisation) est une fédération mondiale
d’organismes nationaux de normalisation (comités membres de I’ISO). L’élaboration
des Normes internationales est confiée aux comités techniques de I’ISO. Chaque
comité membre intéressé par une étude a le droit de faire partie du comité technique
correspondant. Les organisations internationales, gouvernementales et non gouverne-
mentales, en liaison avec I’ISO, participent également aux travaux.
Les projets de Normes internationales adoptés par les comités techniques sont soumis
aux comités membres pour approbation, avant leur acceptation comme Normes inter-
nationales par le Conseil de I’ISO.
La Norme internationale ISO 710/6 a été élaborée par le comité technique ISO/TC 82,
Exploitation minière, et a été soumise aux comités membres en octobre 1983.
Les comités membres des pays suivants l’ont approuvée :
Chine Royaume-Uni
Allemagne, R. F.
Australie France Tchécoslovaquie
Yougoslavie
Autriche Pologne
Bulgarie Roumanie
Aucun comité membre ne l’a désapprouvée.
@ Organisation internationale de normalisation, 1984 l
Imprimé en Suisse
ISO 710/6-1984 (F)
NORME INTERNATIONALE
Symboles graphiques à utiliser sur les cartes, les plans et
les coupes géologiques détaillés -
Partie 6 : Représentation des roches de contact et des
roches ayant subi une transformation métasomatique,
pneumatolytique ou hydrothermale ou une transformation
par altération
2 Généralités
0 Introduction
La genèse des roches traitées dans la présente partie de
L’ISO 710, série de documents consacrés aux symboles graphi-
I’ISO 710 résulte soit de phénomènes isochimiques (auquel cas
ques à utiliser sur les cartes, les plans et les coupes géologiques
il s’agit de roches de contact pur), soit de phénomènes allochi-
détaillés, comprend les parties suivantes :
miques, c’est-à-dire de processus de transformation mettant en
jeu un matériau allochtone et qui se produit aussi, en règle
Partie 1 : Règles générales de représentation.
générale, dans l’auréole d’une masse magmatique intrusive.
Partie 2 : Représentation des roches sédimentaires.
Ces roches doivent, en général, leur existence à des phénomè-
nes pneumatolytiques ou hydrothermaux mettant en jeu des
Partie 3 : Représentation des roches magmatiques.
matériaux allochtones, mais certaines se forment aussi par dif-
fusion moléculaire à température élevée et par autohydratation.
Partie 4 : Représentation des roches métamorphiques.
Ces phénomènes entraînent une transformation plus ou moins
marquée que reflète la roche elle-même.
Partie 5 : Représentation des minéraux.
De temps en temps, les phénomènes de transformation don-
Partie 6 : Représentation des roches de contact et des
nent naissance à des roches de faciès identique à celui des
roches ayant subi une transformation métasomatique,
roches métamorphiques. Ainsi, la séricitisation hydrothermale
pneumatolytique ou hydrothermale ou une transformation
d’une roche volcanique peut-elle conduire à la formation d’un
par altération.
schiste séricitique. Dans ce cas, il est conseillé de reprendre le
symbole de la roche métamorphique, notamment s’il ne sub-
Partie 7 : Symboles tectoniques.
siste rien de la roche volcanique d’origine.
3 Principes de représentation (voir le tableau)
1 Objet et domaine d’application
3.1 Généralités
La présente partie de I’ISO 710 établit une série de symboles
graphiques pour la représentation, sur une carte, un plan ou
Les symboles servent fondamentalement à représenter les
une coupe géologique, des roches dont la formation résulte
roches formées selon les divers processus de transformation.
d’un métamorphisme de contact, d’une transformation méta-
Ils ne cherchent ni à caractériser, ni à interpréter les processus
somatique,
...
Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.