Software Interface for Maintenance Information Collection and Analysis (SIMICA): Common Information Elements

IEC 61639-99:2016(E) is a component of the Software Interface for Maintenance Information Collection and Analysis (SIMICA). The SIMICA family of standards provides an implementation-independent software interfaces to information systems containing data pertinent to the diagnosis and maintenance of complex systems consisting of hardware, software, or any combination thereof. This standard defines EXPRESS information models and XML schemas that together define the common information elements supporting these interfaces. This standard is published as a double logo IEC-IEEE standard.

General Information

Status
Published
Publication Date
07-Nov-2016
Current Stage
PPUB - Publication issued
Completion Date
08-Nov-2016
Ref Project

Buy Standard

Standard
IEC 61636-99:2016 - Software Interface for Maintenance Information Collection and Analysis (SIMICA): Common Information Elements
English language
60 pages
sale 15% off
Preview
sale 15% off
Preview

Standards Content (sample)

IEC 61636-99
Edition 1.0 2016-11
IEEE Std 1636.99
INTERNATIONAL
STANDARD
Software Interface for Maintenance Information Collection and Analysis
(SIMICA): Common Information Elements
IEC 61636-99:2016-11(en) IEEE Std 1636.99-2013
---------------------- Page: 1 ----------------------
THIS PUBLICATION IS COPYRIGHT PROTECTED
Copyright © 2013 IEEE

All rights reserved. IEEE is a registered trademark in the U.S. Patent & Trademark Office, owned by the Institute of

Electrical and Electronics Engineers, Inc. Unless otherwise specified, no part of this publication may be reproduced

or utilized in any form or by any means, electronic or mechanical, including photocopying and microfilm, without

permission in writing from the IEC Central Office. Any questions about IEEE copyright should be addressed to the

IEEE. Enquiries about obtaining additional rights to this publication and other information requests should be

addressed to the IEC or your local IEC member National Committee.
IEC Central Office Institute of Electrical and Electronics Engineers, Inc.
3, rue de Varembé 3 Park Avenue
CH-1211 Geneva 20 New York, NY 10016-5997
Switzerland United States of America
Tel.: +41 22 919 02 11 stds.info@ieee.org
Fax: +41 22 919 03 00 www.ieee.org
info@iec.ch
www.iec.ch
About the IEC

The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes

International Standards for all electrical, electronic and related technologies.
About IEC publications

The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the

latest edition, a corrigenda or an amendment might have been published.
IEC Catalogue - webstore.iec.ch/catalogue Electropedia - www.electropedia.org

The stand-alone application for consulting the entire The world's leading online dictionary of electronic and

bibliographical information on IEC International Standards, electrical terms containing 20 000 terms and definitions in

Technical Specifications, Technical Reports and other English and French, with equivalent terms in 15 additional

documents. Available for PC, Mac OS, Android Tablets and languages. Also known as the International Electrotechnical

iPad. Vocabulary (IEV) online.

IEC publications search - www.iec.ch/searchpub IEC Glossary - std.iec.ch/glossary

The advanced search enables to find IEC publications by a 65 000 electrotechnical terminology entries in English and

variety of criteria (reference number, text, technical French extracted from the Terms and Definitions clause of

committee,…). It also gives information on projects, replaced IEC publications issued since 2002. Some entries have been

and withdrawn publications. collected from earlier publications of IEC TC 37, 77, 86 and

CISPR.
IEC Just Published - webstore.iec.ch/justpublished

Stay up to date on all new IEC publications. Just Published IEC Customer Service Centre - webstore.iec.ch/csc

details all new publications released. Available online and If you wish to give us your feedback on this publication or

also once a month by email. need further assistance, please contact the Customer Service

Centre: csc@iec.ch.
---------------------- Page: 2 ----------------------
IEC 61636-99
Edition 1.0 2016-11
IEEE Std 1636.99™
INTERNATIONAL
STANDARD
Software Interface for Maintenance Information Collection and Analysis
(SIMICA): Common Information Elements
INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
ICS 25.040.01; 35.060 ISBN 978-2-8322-3685-7

Warning! Make sure that you obtained this publication from an authorized distributor.

® Registered trademark of the International Electrotechnical Commission
---------------------- Page: 3 ----------------------
IEC 61636-99:2016
– i – IEEE Std 1636.99-2013
Contents

1. Overview .................................................................................................................................................... 1

1.1 General ................................................................................................................................................ 1

1.2 Application of this documents annexes ............................................................................................... 2

1.3 Scope ................................................................................................................................................... 2

1.4 Referenced IEEE Standards................................................................................................................. 2

1.5 Application .......................................................................................................................................... 2

1.6 Conventions used in this document ..................................................................................................... 2

2. Normative references.................................................................................................................................. 4

3. Definitions, acronyms, and abbreviations .................................................................................................. 4

3.1 Definitions ........................................................................................................................................... 4

3.2 Acronyms and abbreviations ............................................................................................................... 5

4. SIMICA common elements........................................................................................................................ 5

4.1 SIMICA common element partitioning ............................................................................................... 5

4.2 Use of the IEEE Std 1671 Common.xsd schema................................................................................. 6

5. EXPRESS model, EXPRESS-G diagram, and XML schema names and locations ................................... 6

6. Conformance .............................................................................................................................................. 8

7. XML schema extensibility.......................................................................................................................... 8

Annex A (normative) SimicaCommon XML schema ................................................................................. 10

A.1 SIMICACommon.xsd....................................................................................................................... 10

Annex B (normative) SimicaCommon EXPRESS models........................................................................... 17

B.1 SIMICA_COMMON_MODEL_DOT_99........................................................................................ 17

B.2 SIMICACommon model EXPRESS-G diagrams ............................................................................. 50

Annex C (informative) Bibliography............................................................................................................ 58

Annex D (informative) IEEE list of participants...........................................................................................60

---------------------- Page: 4 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – ii –
62)7:$5(,17(5)$&(
)250$,17(1$1&(,1)250$7,21&2//(&7,21
$1'$1$/<6,6 6,0,&$ 
&20021,1)250$7,21(/(0(176
)25(:25'

  7KH,QWHUQDWLRQDO(OHFWURWHFKQLFDO&RPPLVVLRQ ,(& LVDZRUOGZLGHRUJDQL]DWLRQIRUVWDQGDUGL]DWLRQFRPSULVLQJ

DOO QDWLRQDO HOHFWURWHFKQLFDO FRPPLWWHHV ,(& 1DWLRQDO &RPPLWWHHV 7KHREMHFWRI,(&LVWRSURPRWH

LQWHUQDWLRQDOFRRSHUDWLRQRQDOOTXHVWLRQVFRQFHUQLQJVWDQGDUGL]DWLRQLQWKHHOHFWULFDODQGHOHFWURQLFILHOGV7R

WKLVHQGDQGLQDGGLWLRQWRRWKHUDFWLYLWLHV,(&SXEOLVKHV,QWHUQDWLRQDO6WDQGDUGV7HFKQLFDO6SHFLILFDWLRQV

7HFKQLFDO 5HSRUWV 3XEOLFO\ $YDLODEOH 6SHFLILFDWLRQV 3$6  DQG *XLGHV KHUHDIWHU UHIHUUHG WR DV ³,(&

3XEOLFDWLRQ V ´ 7KHLUSUHSDUDWLRQLVHQWUXVWHGWRWHFKQLFDOFRPPLWWHHVDQ\,(&1DWLRQDO&RPPLWWHHLQWHUHVWHG

LQ WKH VXEMHFW GHDOW ZLWK PD\ SDUWLFLSDWH LQ WKLV SUHSDUDWRU\ ZRUN ,QWHUQDWLRQDO JRYHUQPHQWDO DQG QRQ

JRYHUQPHQWDORUJDQL]DWLRQVOLDLVLQJZLWKWKH,(&DOVRSDUWLFLSDWHLQWKLVSUHSDUDWLRQ

,(((6WDQGDUGVGRFXPHQWVDUHGHYHORSHGZLWKLQ,(((6RFLHWLHVDQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH

,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG,(((GHYHORSVLWVVWDQGDUGVWKURXJKDFRQVHQVXV

GHYHORSPHQWSURFHVVZKLFKEULQJVWRJHWKHUYROXQWHHUVUHSUHVHQWLQJYDULHGYLHZSRLQWVDQGLQWHUHVWVWRDFKLHYH

WKHILQDOSURGXFW9ROXQWHHUVDUHQRWQHFHVVDULO\PHPEHUVRI,(((DQGVHUYHZLWKRXWFRPSHQVDWLRQ:KLOH,(((

DGPLQLVWHUVWKHSURFHVVDQGHVWDEOLVKHVUXOHVWRSURPRWHIDLUQHVVLQWKHFRQVHQVXVGHYHORSPHQWSURFHVV,(((

GRHV QRW LQGHSHQGHQWO\ HYDOXDWH WHVW RU YHULI\ WKH DFFXUDF\ RI DQ\ RI WKH LQIRUPDWLRQ FRQWDLQHG LQ LWV

VWDQGDUGV8VHRI,(((6WDQGDUGVGRFXPHQWVLVZKROO\YROXQWDU\,(((GRFXPHQWVDUHPDGHDYDLODEOHIRUXVH

VXEMHFWWRLPSRUWDQWQRWLFHVDQGOHJDOGLVFODLPHUV VHHKWWSVWDQGDUGVLHHHRUJ,35GLVFODLPHUVKWPOIRUPRUH

LQIRUPDWLRQ 

,(&FROODERUDWHVFORVHO\ZLWK,(((LQDFFRUGDQFHZLWKFRQGLWLRQVGHWHUPLQHGE\DJUHHPHQWEHWZHHQWKHWZR

RUJDQL]DWLRQV

  7KHIRUPDOGHFLVLRQVRI,(&RQWHFKQLFDOPDWWHUVH[SUHVVDVQHDUO\DVSRVVLEOHDQLQWHUQDWLRQDOFRQVHQVXVRI

RSLQLRQRQWKHUHOHYDQWVXEMHFWVVLQFHHDFKWHFKQLFDOFRPPLWWHHKDVUHSUHVHQWDWLRQIURPDOOLQWHUHVWHG,(&

1DWLRQDO&RPPLWWHHV7KHIRUPDOGHFLVLRQVRI,(((RQWHFKQLFDOPDWWHUVRQFHFRQVHQVXVZLWKLQ,(((6RFLHWLHV

DQG6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVKDVEHHQUHDFKHGLVGHWHUPLQHGE\DEDODQFHGEDOORWRIPDWHULDOO\

LQWHUHVWHG SDUWLHV ZKR LQGLFDWH LQWHUHVW LQ UHYLHZLQJ WKH SURSRVHG VWDQGDUG )LQDO DSSURYDO RI WKH ,(((

VWDQGDUGVGRFXPHQWLVJLYHQE\WKH,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG

  ,(&,((( 3XEOLFDWLRQV KDYH WKH IRUP RI UHFRPPHQGDWLRQV IRU LQWHUQDWLRQDO XVH DQG DUH DFFHSWHG E\ ,(&

1DWLRQDO&RPPLWWHHV,(((6RFLHWLHVLQWKDWVHQVH:KLOHDOOUHDVRQDEOHHIIRUWVDUHPDGHWRHQVXUHWKDWWKH

WHFKQLFDOFRQWHQWRI,(&,(((3XEOLFDWLRQVLVDFFXUDWH,(&RU,(((FDQQRWEHKHOGUHVSRQVLEOHIRUWKHZD\LQ

ZKLFKWKH\DUHXVHGRUIRUDQ\PLVLQWHUSUHWDWLRQE\DQ\HQGXVHU

  ,QRUGHUWRSURPRWHLQWHUQDWLRQDOXQLIRUPLW\,(&1DWLRQDO&RPPLWWHHVXQGHUWDNHWRDSSO\,(&3XEOLFDWLRQV

LQFOXGLQJ,(&,(((3XEOLFDWLRQV WUDQVSDUHQWO\WRWKHPD[LPXPH[WHQWSRVVLEOHLQWKHLUQDWLRQDODQGUHJLRQDO

SXEOLFDWLRQV$Q\GLYHUJHQFHEHWZHHQDQ\,(&,(((3XEOLFDWLRQDQGWKHFRUUHVSRQGLQJQDWLRQDORUUHJLRQDO

SXEOLFDWLRQVKDOOEHFOHDUO\LQGLFDWHGLQWKHODWWHU

  ,(&DQG,(((GRQRWSURYLGHDQ\DWWHVWDWLRQRIFRQIRUPLW\,QGHSHQGHQWFHUWLILFDWLRQERGLHVSURYLGHFRQIRUPLW\

DVVHVVPHQWVHUYLFHVDQGLQVRPHDUHDVDFFHVVWR,(&PDUNVRIFRQIRUPLW\,(&DQG,(((DUHQRWUHVSRQVLEOH

IRUDQ\VHUYLFHVFDUULHGRXWE\LQGHSHQGHQWFHUWLILFDWLRQERGLHV

  $OOXVHUVVKRXOGHQVXUHWKDWWKH\KDYHWKHODWHVWHGLWLRQRIWKLVSXEOLFDWLRQ

  1ROLDELOLW\VKDOODWWDFKWR,(&RU,(((RUWKHLUGLUHFWRUVHPSOR\HHVVHUYDQWVRUDJHQWVLQFOXGLQJLQGLYLGXDO

H[SHUWVDQGPHPEHUVRIWHFKQLFDOFRPPLWWHHVDQG,(&1DWLRQDO&RPPLWWHHVRUYROXQWHHUVRI,(((6RFLHWLHV

DQGWKH6WDQGDUGV&RRUGLQDWLQJ&RPPLWWHHVRIWKH,(((6WDQGDUGV$VVRFLDWLRQ ,(((6$ 6WDQGDUGV%RDUG

IRUDQ\SHUVRQDOLQMXU\SURSHUW\GDPDJHRURWKHUGDPDJHRIDQ\QDWXUHZKDWVRHYHUZKHWKHUGLUHFWRULQGLUHFW

RUIRUFRVWV LQFOXGLQJOHJDOIHHV DQGH[SHQVHVDULVLQJRXWRIWKHSXEOLFDWLRQXVHRIRUUHOLDQFHXSRQWKLV

,(&,(((3XEOLFDWLRQRUDQ\RWKHU,(&RU,(((3XEOLFDWLRQV

  $WWHQWLRQLVGUDZQWRWKHQRUPDWLYHUHIHUHQFHVFLWHGLQWKLVSXEOLFDWLRQ8VHRIWKHUHIHUHQFHGSXEOLFDWLRQVLV

LQGLVSHQVDEOHIRUWKHFRUUHFWDSSOLFDWLRQRIWKLVSXEOLFDWLRQ

  $WWHQWLRQ LV GUDZQ WR WKH SRVVLELOLW\ WKDW LPSOHPHQWDWLRQ RI WKLV ,(&,((( 3XEOLFDWLRQ PD\ UHTXLUH XVH RI

PDWHULDOFRYHUHGE\SDWHQWULJKWV%\SXEOLFDWLRQRIWKLVVWDQGDUGQRSRVLWLRQLVWDNHQZLWKUHVSHFWWRWKH

H[LVWHQFHRUYDOLGLW\RIDQ\SDWHQWULJKWVLQFRQQHFWLRQWKHUHZLWK,(&RU,(((VKDOOQRWEHKHOGUHVSRQVLEOHIRU

LGHQWLI\LQJ(VVHQWLDO3DWHQW&ODLPVIRUZKLFKDOLFHQVHPD\EHUHTXLUHGIRUFRQGXFWLQJLQTXLULHVLQWRWKHOHJDO

YDOLGLW\ RU VFRSH RI 3DWHQW &ODLPV RU GHWHUPLQLQJ ZKHWKHU DQ\ OLFHQVLQJ WHUPV RU FRQGLWLRQV SURYLGHG LQ

FRQQHFWLRQZLWKVXEPLVVLRQRID/HWWHURI$VVXUDQFHLIDQ\RULQDQ\OLFHQVLQJDJUHHPHQWVDUHUHDVRQDEOHRU

QRQGLVFULPLQDWRU\8VHUVRIWKLVVWDQGDUGDUHH[SUHVVO\DGYLVHGWKDWGHWHUPLQDWLRQRIWKHYDOLGLW\RIDQ\SDWHQW

ULJKWVDQGWKHULVNRILQIULQJHPHQWRIVXFKULJKWVLVHQWLUHO\WKHLURZQUHVSRQVLELOLW\

---------------------- Page: 5 ----------------------
IEC 61636-99:2016
– iii – IEEE Std 1636.99-2013

,QWHUQDWLRQDO6WDQGDUG ,(&,(((6WGKDVEHHQSURFHVVHGWKURXJK,(&

WHFKQLFDOFRPPLWWHH(OHFWURQLFVDVVHPEO\WHFKQRORJ\ XQGHU WKH,(&,((('XDO/RJR

$JUHHPHQW
7KHWH[WRIWKLVVWDQGDUGLVEDVHGRQWKHIROORZLQJGRFXPHQWV
,(((6WG )',6 5HSRUWRQYRWLQJ
   )',6 59'

)XOOLQIRUPDWLRQRQWKHYRWLQJIRUWKHDSSURYDORIWKLVVWDQGDUGFDQEHIRXQGLQWKHUHSRUWRQ

YRWLQJLQGLFDWHGLQWKHDERYHWDEOH

7KH,(&7HFKQLFDO&RPPLWWHHDQG,(((7HFKQLFDO&RPPLWWHHKDYHGHFLGHGWKDWWKHFRQWHQWV

RIWKLVSXEOLFDWLRQZLOOUHPDLQXQFKDQJHGXQWLOWKHVWDELOLW\GDWHLQGLFDWHGRQWKH,(&ZHEVLWH

XQGHUKWWSZHEVWRUHLHFFKLQWKHGDWDUHODWHGWRWKHVSHFLILFSXEOLFDWLRQ$WWKLVGDWHWKH

SXEOLFDWLRQZLOOEH
‡ UHFRQILUPHG
‡ ZLWKGUDZQ
‡ UHSODFHGE\DUHYLVHGHGLWLRQRU
‡ DPHQGHG
---------------------- Page: 6 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – iv –
IEEE Standard for Software Interface
for Maintenance Information Collection
and Analysis (SIMICA):
Common Information Elements
Sponsor
IEEE Standards Coordinating Committees on
Test and Diagnosis for Electronic Systems (SCC20)
Approved 23 August 2013
IEEE-SA Standards Board
---------------------- Page: 7 ----------------------
IEC 61636-99:2016
– v – IEEE Std 1636.99-2013

Abstract: This standard is intended to promote and facilitate interoperability between

components of SIMICA. The standard defines EXPRESS information models and XML schemas

that together define the common information elements supporting these interfaces.

Keywords: automated test system (ATS), eXtensible markup language (XML), IEEE 1636.99™,

session information, Software Interface for Maintenance Information Collection and Analysis

(SIMICA), test results, XML schema
---------------------- Page: 8 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – vi –
I(((,ntroduction

This introduction is not part of IEEE Std 1636.99™-2013, IEEE Standard for Software Interface for Maintenance

Information Collection and Analysis (SIMICA): Common Information Elements.

Maintainers of complex systems require the ability to capture and share historical test and maintenance-

related information in a way that supports such activities as performance analysis, post-production product

improvement, maintenance process improvement, and diagnostic maturation. Principal stakeholders of this

project include but are not limited to maintenance organizations within various Departments/Ministries of

Defense, the commercial airlines, the automotive industry, and the telecommunications industry. This

standard is being developed as a component of the IEEE 1636™ Software Interface for Maintenance

Information Collection and Analysis (SIMICA) project. SIMICA’s purpose is to specify a software

interface for access, exchange, and analysis of product diagnostic and maintenance information.

Maintenance action information provides a subset of the data needed to satisfy SIMICIA requirements.

The use of formal information models will facilitate exchanging historical maintenance information

between information systems and analysis tools. The models will facilitate creating open system software

architectures for maturing system diagnostics.

The XML schema described in this standard where appropriate utilizes and references components of the

IEEE Std 1671™ schema set.

It is anticipated that these schemas will be used throughout industries that utilize diagnostic and

maintenance data as an exchange format that can be understood by humans or machines. In order to ensure

wide acceptance throughout the user community, the schemas have been designed to encompass a broad

range of use cases. To accommodate use cases beyond the released design, the schemas provide means for

user extensibility.
---------------------- Page: 9 ----------------------
IEC 61636-99:2016
– vii – IEEE Std 1636.99-2013
---------------------- Page: 10 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – 1 –
Software Interface
for Maintenance Information Collection
and Analysis (SIMICA):
Common Information Elements

IMPORTANT NOTICE: IEEE Standards documents are not intended to ensure safety, security, health,

or environmental protection, or ensure against interference with or from other devices or networks.

Implementers of IEEE Standards documents are responsible for determining and complying with all

appropriate safety, security, environmental, health, and interference protection practices and all

applicable laws and regulations.

This IEEE document is made available for use subject to important notices and legal disclaimers.

These notices and disclaimers appear in all publications containing this document and may

be found under the heading “Important Notice” or “Important Notices and Disclaimers

Concerning IEEE Documents.” They can also be obtained on request from IEEE or viewed at

http://standards.ieee.org/IPR/disclaimers.html.
1. Overview
1.1 General

This standard, which is a component of the Software Interface for Maintenance Information Collection and

Analysis (SIMICA) standard, was developed by the Diagnostic and Maintenance Control Subcommittee of

the IEEE Standards Coordinating Committee 20 (SCC20) on Test and Diagnosis for Electronic Systems to

provide standard, unambiguous definitions of common SIMICA element semantics, and interrelationships.

This standard specifically describes a set of formal specifications consisting of the logical representation of

the information that is common between IEEE Std 1636.1™ and IEEE Std 1636.2™, which may be used

during related diagnostic and maintenance processes. The information model contained in this document

provides a normative formal specification of the information concepts and precise semantics that support

the unambiguous exchange of information between producers and consumers in a platform-independent

manner.
---------------------- Page: 11 ----------------------
IEC 61636-99:2016
– 2 – IEEE Std 1636.99-2013

The schemas described in this document are intended to be shared by all SIMICA “dot” standards. The

Express schema in this standard is based on ISO 10303-11:1994 [B9] . The XML schema associated with

this standard is based on the W3C eXtensible Markup Language (XML) 1.0 Recommendation [B1] .

1.2 Application of this documents annexes

This document includes three annexes. Of these three, two are normative (Annex A and Annex B).

Annex A contains the description of each of the XML schema elements and types.
Annex B contains the description of the EXPRESS and EXPRESS-G model elements.

Annex C is informative, and thus is provided strictly as information, for both users and maintainers of this

document.
1.3 Scope

The SIMICA family of standards provides an implementation-independent software interfaces to information

systems containing data pertinent to the diagnosis and maintenance of complex systems consisting of

hardware, software, or any combination thereof. This standard defines EXPRESS information models and

XML schemas that together define the common information elements supporting these interfaces.

1.4 Referenced IEEE Standards

SIMICA Common makes reference to IEEE Std 1671™-2010 Annex B.1. This normatively referenced

IEEE standard, when utilized, is therefore considered part of the SIMICA definition.

1.5 Application

This standard provides a specification for information shared by SIMICA “dot” standards (e.g., IEEE Std

1636.1, IEEE Std 1636.2). Anticipated users of this standard include the following:

a) System developers
b) System maintainers
c) Reliability, maintainability, and diagnostic analytical applications
1.6 Conventions used in this document
1.6.1 General

In accordance with IEEE Standards Style Manual [B3], any schema examples will be shown in $PVSJFS

font. In cases where instance document examples are necessary to depict clearly use of a schema type or

element, such examples will also be shown in $PVSJFS font. When the characters “...” appear in an

example, it indicates that the example component is incomplete.
The numbers in brackets correspond to those of the bibliography in Annex C.
W3C is a registered trademark of the World Wide Web Consortium.
---------------------- Page: 12 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – 3 –

All simple types, complex types, attribute groups, and elements will be listed; explanatory information will

be provided, along with examples if additional clarification is needed. The explanatory information shall

include information on the intended use of the elements and/or attributes where the name of the entity does

not clearly indicate its intended use. For elements derived from another source type (e.g., an abstract type),

only attributes which extend the source type shall be listed; details regarding the base type shall be listed

along with the base type.

When referring to an attribute of an XML element, the convention of [element]@[attribute] shall be used.

In cases where an attribute name is referred to with no associated element, the attribute name shall be

enclosed in single quotes.

In tables that describe XML elements, the column “Use” indicates the occurrence constraints for each

element.
a) “Required” indicates that the element shall appear exactly once.
b) “Optional” indicates that the element may appear once or not at all.

c) “1..’” indicates that the element shall appear at least once and may appear multiple times.

d) “0..’” indicates that the element may appear multiple times, once, or not at all.

All specifications for the EXPRESS language are given in the Courier type font which includes

references to entity and attribute names in the supporting text.

This standard uses the vocabulary and definitions of relevant IEEE standards. In case of conflict of

definitions, except for those portions quoted from standards, the following precedence shall be observed: 1)

Clause 3, and 2) The IEEE Standards Dictionary Online [B2] .
1.6.2 Word usage

In accordance with the IEEE Standards Style Manual [B3], the word shall is used to indicate mandatory

requirements strictly to be followed in order to conform to the standard and from which no deviation is

permitted (shall equals is required to). The use of the word must is used only to describe unavoidable

situations. The use of the word will is only used in statements of fact.

The word should is used to indicate that among several possibilities one is recommended as particularly

suitable, without mentioning or excluding others (should equals is recommended that).

The word may is used to indicate a course of action permissible within the limits of the standard (may

equals is permitted to).

The word can is used for statements of possibility and capability (can equals is able to).

IEEE Standards Dictionary Online subscription is available at:
http://www.ieee.org/portal/innovate/products/standard/standards_dictionary.html
---------------------- Page: 13 ----------------------
IEC 61636-99:2016
– 4 – IEEE Std 1636.99-2013
2. Normative references

The following referenced documents are indispensable for the application of this document (i.e., they must

be understood and used, so each referenced document is cited in text and its relationship to this document is

explained). For dated references, only the edition cited applies. For undated references, the latest edition of

the referenced document (including any amendments or corrigenda) applies.

IEEE Std 1636™-2009, IEEE Standard for Software Interface for Maintenance Information Collection and

4, 5
Analysis (SIMICA).

IEEE Std 1671™-2010, IEEE Standard for Automatic Test Markup Language (ATML) for Exchanging

Automatic Test Equipment and Test Information via XML.
3. Definitions, acronyms, and abbreviations
3.1 Definitions

For the purposes of this document, the following terms and definitions apply. The IEEE Standards

Dictionary Online [B2] should be consulted for terms not defined in this clause. In the event a term is

explicitly redefined, or defined in more detail, in an SIMICA component standard, the component standards

definition shall be normative for that SIMICA component standard.

component (in eXtensible Markup Language (XML) schema): The generic term for the building blocks

that compose the abstract data model of the schema.

eXtensible Markup Language (XML) attribute: Name-value pair associated with an XML element.

eXtensible Markup Language (XML) document: A (text) data object that conforms to the XML

requirements for being well-formed (as defined by W3C).

eXtensible Markup Language (XML) namespace: A method for distinguishing XML elements and

attributes that may have the same name but different meanings. A URL is used as a prefix to a “local

name.” This combination ensures the uniqueness of the element or attribute name. The URL is used only as

a way to create a unique prefix and does not have to resolve to a real page on the Internet.

NOTE—See Namespaces in XML 1.0 [B10] and Schenk and Wilson [B11] .

eXtensible Markup Language (XML) schema: The structure or framework used to define a data record.

This includes each field’s name, type, shape, dimension, and mapping.

framework: A framework is a real or conceptual structure expressed as a set of abstract classes. The

framework provides a context for the components to be used.

instance document: A textual information set grouped for some purpose that is governed by a single XML

schema.

IEEE publications are available from The Institute of Electrical and Electronics Engineers (http://standards.ieee.org/).

The IEEE standards or products referred to in this clause are trademarks of The Institute of Electrical and Electronics Engineers, Inc.

Notes in text, tables, and figures are given for information only and do not contain requirements needed to implement the standard.

---------------------- Page: 14 ----------------------
IEC 61636-99:2016
IEEE Std 1636.99-2013 – 5 –

maintenance: Activity intended to keep equipment (hardware) or programs (software) in satisfactory

working condition, including replacements, adjustments, repairs, software/firmware updates, and program

improvements. Maintenance can be preventative or corrective (adapted from MIL-STD-1309D [B12]).

particle (in eXtensible Markup Language (XML) schema): A kind of component.

sequence (in XML schema): A compositor for model group schema components which specifies that

subordinate elements in an instance document must correspond, in order, to the specified particles.

3.2 Acronyms and abbreviations

AI-ESTATE Artificial Intelligence Exchange and Service Tie to All Test Environments

ATML Automatic Test Markup Language
ATS automatic test system
ISO International Organization for Standardization
OID object identifier
SIMICA Software Interface for Maintenance Information Collection and Analysis
URL uniform resource locator
URN uniform resource name
UUT unit under test
W3C World Wide Web Consortium
XML eXtensible Markup Language
4. SIMICA common elements
4.1 SIMICA common element partitioning

Common elements provide for the definition of XML types and attributes that are utilized within more than

one SIMICA family XML schema.

Common element XML schemas are reference XML schemas containing only type definitions that may be

used in other XML schemas. They have no root element, and there will be no instance documents directly

validated against them.

Having each SIMICA family XML schema include the SIMICA common elements allows for a consistent

definition of shared XML types and prevents each XML schema from defining XML types used by other

SIMICA family XML schemas (which would have had to also define that XML type, possibly differently).

SIMICA Common elements as a result are simply a toolbox for the SIMICA family XML schemas to

include.
---------------------- Page: 15 ----------------------
IEC 61636-99:2016
– 6 – IEEE Std 1636.99-2013
SIMICA defines one common element XML schema:
SIMICACommon.xsd: provides SIMICA-unique types and attributes.
This SIMICA common element XML schema is defined in Annex A.

The EXPRESS and EXPRESS-G models of SIMICA Common elements are defined in Annex B.

Every SIMICA family component XML schema shall include the SIMICA common element XML schema.

Every SIMICA family component shall reference the S
...

Questions, Comments and Discussion

Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.