SIST EN 302 065-2 V2.1.1:2017
(Main)Short Range Devices (SRD) using Ultra Wide Band technology (UWB) - Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU - Part 2: Requirements for UWB location tracking
General Information
- Abstract
The present document applies to transceivers, transmitters and receivers utilizing Ultra WideBand (UWB) technologies
and used for location tracking purposes.
The present document applies to impulse, modified impulse and RF carrier based UWB communication technologies.
The present document applies to fixed, mobile or portable applications, e.g. the present document applies to the
following equipment types:
• stand-alone radio equipment with or without its own control provisions;
• plug-in radio devices intended for use with, or within, a variety of host systems, e.g. personal computers, handheld
terminals, etc.;
• plug-in radio devices intended for use within combined equipment, e.g. cable modems, set-top boxes, access
points, etc.;
• combined equipment or a combination of a plug-in radio device and a specific type of host equipment.
The present document applies to UWB equipment with an output connection used with a dedicated antenna or UWB
equipment with an integral antenna.
The present document covers three different types of location tracking system, which may use either of the UWB
technologies listed previously:
• LT1 systems: These systems, operating in the 6 GHz to 9 GHz region (see CEPT Report 45 [i.13]), are
intended for general location tracking of people and objects. They operate on an unlicensed basis. The
transmitting terminals in these systems are mobile (indoors or outdoors), or fixed (indoors only). Fixed
outdoor LT1 transmitters are not permitted. Typically, LT1 transmitters are mobile location tracking tags
which are attached to people or objects, and tags are tracked using a fixed receiver infrastructure to only
receive the UWB emission emitted by the tags, ETSI EG 201 399 [i.1].
• LT2 systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)09 [i.8]), are
intended for person and object tracking and industrial applications at well-defined locations. The transmitting
terminals in these systems may be located indoors or outdoors, and may be fixed or mobile. They operate at
fixed sites and may be subject to registration and authorization, provided local coordination with possible
interference victims has been performed, ECC Report 167 [i.10] and ECC Report 170 [i.11].
• LAES systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)10 [i.9]), are
intended for tracking staff belonging to the fire and other emergency services, who need to work in dangerous
situations. Being able to track such people, even when deep inside a building, provides an important
enhancement to command and control and to their personal safety. Typically, an LAES system is deployed
temporarily at the scene of a fire or other emergency in a building. Licences may be required for user
organization, ECC Report 167 [i.10] and ECC Report 170 [i.11].
Some individual location tracking devices may be able to operate within different kinds of location tracking systems,
and therefore may meet (in different modes) the requirements of any or all of LT1, LT2 and LAES.
The present document does not cover UWB transmitters whose authorization to operate depends solely on the tests set
out in the present document and which are installed or used in flying models, aircraft and other forms of aviation.
Furthermore, it does not cover LT1 UWB transmitters that are operated on board a road or rail vehicle running on a
public network or highway.
- Status
- Published
- Public Enquiry End Date
- 30-Jun-2016
- Publication Date
- 29-Nov-2016
- Technical Committee
- MOC - Mobile Communications
- Current Stage
- 6060 - National Implementation/Publication (Adopted Project)
- Start Date
- 28-Nov-2016
- Due Date
- 02-Feb-2017
- Completion Date
- 30-Nov-2016
Buy Documents
ETSI EN 302 065-2 V2.1.0 (2016-04) - Short Range Devices (SRD) using Ultra Wide Band technology (UWB); Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU; Part 2: Requirements for UWB location tracking
ETSI EN 302 065-2 V2.1.1 (2016-11) - Short Range Devices (SRD) using Ultra Wide Band technology (UWB); Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU; Part 2: Requirements for UWB location tracking
Overview
SIST EN 302 065-2 V2.1.1:2017 is a harmonised standard developed by SIST, aligning with the essential requirements of Article 3.2 of the Directive 2014/53/EU. This standard specifies the regulatory framework and technical requirements for Short Range Devices (SRD) utilizing Ultra Wide Band (UWB) technology specifically for location tracking applications. The standard applies to a wide range of UWB transceivers, transmitters, and receivers, supporting impulse, modified impulse, and RF carrier-based UWB technologies. It relates to fixed, mobile, and portable devices intended for both consumer and industrial use, as well as for specialized applications in safety and emergency services.
Key Topics
- Scope:
- Covers all radio equipment using UWB for location tracking, including stand-alone units, plug-in modules, and combined systems.
- Applicable to devices with either dedicated or integral antennas.
- Location Tracking Systems Classifications:
- LT1 Systems:
- General tracking of people and objects.
- Operate unlicensed in 6 GHz to 9 GHz bands.
- Mobile transmitters (indoor/outdoor) and indoor fixed transmitters, typically for asset and personnel tracking.
- LT2 Systems:
- For industrial and defined site applications.
- Operate in 3.1 GHz to 4.8 GHz bands.
- Can be used indoors/outdoors, mobile or fixed, often requiring registration and local coordination.
- LAES Systems:
- Designed for tracking emergency service staff in hazardous environments.
- Operate in 3.1 GHz to 4.8 GHz bands.
- Deployable on-site during emergencies; may require licensing.
- LT1 Systems:
- Equipment Coverage:
- Stand-alone devices
- Plug-in modules for host systems (PCs, handhelds)
- Integration with combined equipment (modems, access points)
- Exclusions:
- Aviation and airborne applications.
- On-board transmitters in road and rail vehicles operating on public networks.
Applications
Ultra Wide Band (UWB) location tracking devices offer secure, precise, and real-time location information for a broad spectrum of use cases, including:
- Industrial Environments:
- Automated asset tracking and inventory management.
- Worker safety through personnel tracking in warehouses or manufacturing plants.
- Monitoring of machinery and high-value tools.
- Consumer and Commercial Solutions:
- Proximity-based services, electronic tagging, and lost-item finders.
- Integration into smart devices for enhanced spatial awareness and security.
- Public Safety and Emergency Services:
- Tracking and safeguarding emergency personnel in hazardous areas.
- Temporary deployment of LAES systems at emergency scenes (firefighting, rescue operations).
- Healthcare:
- Patient and equipment tracking within medical facilities.
By adhering to this standard, manufacturers and systems integrators ensure compliance with European regulations, facilitating market access and enhancing interoperability, safety, and reliability of UWB location tracking solutions.
Related Standards
For comprehensive compliance and technical insight, the following related standards should be considered:
- ETSI EN 302 065-1: General requirements for UWB location tracking devices.
- ETSI EN 302 065-3: Receiver technical requirements for UWB location tracking systems.
- ECC/REC(11)09 and ECC/REC(11)10: Recommendations on frequency bands for location tracking applications.
- Directive 2014/53/EU: Regulatory framework for radio equipment in the European Union.
SIST EN 302 065-2 V2.1.1:2017 provides a robust baseline for the compliant development and deployment of UWB-based location tracking technologies, covering essential regulatory, operational, and interoperability requirements for the European market.
Buy Documents
ETSI EN 302 065-2 V2.1.0 (2016-04) - Short Range Devices (SRD) using Ultra Wide Band technology (UWB); Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU; Part 2: Requirements for UWB location tracking
ETSI EN 302 065-2 V2.1.1 (2016-11) - Short Range Devices (SRD) using Ultra Wide Band technology (UWB); Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU; Part 2: Requirements for UWB location tracking
Get Certified
Connect with accredited certification bodies for this standard

ANCE
Mexican certification and testing association.

Intertek Slovenia
Intertek testing, inspection, and certification services in Slovenia.
LNE (Laboratoire National de Métrologie et d'Essais)
French national laboratory for metrology and testing.
Sponsored listings
Frequently Asked Questions
SIST EN 302 065-2 V2.1.1:2017 is a standard published by the Slovenian Institute for Standardization (SIST). Its full title is "Short Range Devices (SRD) using Ultra Wide Band technology (UWB) - Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU - Part 2: Requirements for UWB location tracking". This standard covers: The present document applies to transceivers, transmitters and receivers utilizing Ultra WideBand (UWB) technologies and used for location tracking purposes. The present document applies to impulse, modified impulse and RF carrier based UWB communication technologies. The present document applies to fixed, mobile or portable applications, e.g. the present document applies to the following equipment types: • stand-alone radio equipment with or without its own control provisions; • plug-in radio devices intended for use with, or within, a variety of host systems, e.g. personal computers, handheld terminals, etc.; • plug-in radio devices intended for use within combined equipment, e.g. cable modems, set-top boxes, access points, etc.; • combined equipment or a combination of a plug-in radio device and a specific type of host equipment. The present document applies to UWB equipment with an output connection used with a dedicated antenna or UWB equipment with an integral antenna. The present document covers three different types of location tracking system, which may use either of the UWB technologies listed previously: • LT1 systems: These systems, operating in the 6 GHz to 9 GHz region (see CEPT Report 45 [i.13]), are intended for general location tracking of people and objects. They operate on an unlicensed basis. The transmitting terminals in these systems are mobile (indoors or outdoors), or fixed (indoors only). Fixed outdoor LT1 transmitters are not permitted. Typically, LT1 transmitters are mobile location tracking tags which are attached to people or objects, and tags are tracked using a fixed receiver infrastructure to only receive the UWB emission emitted by the tags, ETSI EG 201 399 [i.1]. • LT2 systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)09 [i.8]), are intended for person and object tracking and industrial applications at well-defined locations. The transmitting terminals in these systems may be located indoors or outdoors, and may be fixed or mobile. They operate at fixed sites and may be subject to registration and authorization, provided local coordination with possible interference victims has been performed, ECC Report 167 [i.10] and ECC Report 170 [i.11]. • LAES systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)10 [i.9]), are intended for tracking staff belonging to the fire and other emergency services, who need to work in dangerous situations. Being able to track such people, even when deep inside a building, provides an important enhancement to command and control and to their personal safety. Typically, an LAES system is deployed temporarily at the scene of a fire or other emergency in a building. Licences may be required for user organization, ECC Report 167 [i.10] and ECC Report 170 [i.11]. Some individual location tracking devices may be able to operate within different kinds of location tracking systems, and therefore may meet (in different modes) the requirements of any or all of LT1, LT2 and LAES. The present document does not cover UWB transmitters whose authorization to operate depends solely on the tests set out in the present document and which are installed or used in flying models, aircraft and other forms of aviation. Furthermore, it does not cover LT1 UWB transmitters that are operated on board a road or rail vehicle running on a public network or highway.
The present document applies to transceivers, transmitters and receivers utilizing Ultra WideBand (UWB) technologies and used for location tracking purposes. The present document applies to impulse, modified impulse and RF carrier based UWB communication technologies. The present document applies to fixed, mobile or portable applications, e.g. the present document applies to the following equipment types: • stand-alone radio equipment with or without its own control provisions; • plug-in radio devices intended for use with, or within, a variety of host systems, e.g. personal computers, handheld terminals, etc.; • plug-in radio devices intended for use within combined equipment, e.g. cable modems, set-top boxes, access points, etc.; • combined equipment or a combination of a plug-in radio device and a specific type of host equipment. The present document applies to UWB equipment with an output connection used with a dedicated antenna or UWB equipment with an integral antenna. The present document covers three different types of location tracking system, which may use either of the UWB technologies listed previously: • LT1 systems: These systems, operating in the 6 GHz to 9 GHz region (see CEPT Report 45 [i.13]), are intended for general location tracking of people and objects. They operate on an unlicensed basis. The transmitting terminals in these systems are mobile (indoors or outdoors), or fixed (indoors only). Fixed outdoor LT1 transmitters are not permitted. Typically, LT1 transmitters are mobile location tracking tags which are attached to people or objects, and tags are tracked using a fixed receiver infrastructure to only receive the UWB emission emitted by the tags, ETSI EG 201 399 [i.1]. • LT2 systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)09 [i.8]), are intended for person and object tracking and industrial applications at well-defined locations. The transmitting terminals in these systems may be located indoors or outdoors, and may be fixed or mobile. They operate at fixed sites and may be subject to registration and authorization, provided local coordination with possible interference victims has been performed, ECC Report 167 [i.10] and ECC Report 170 [i.11]. • LAES systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)10 [i.9]), are intended for tracking staff belonging to the fire and other emergency services, who need to work in dangerous situations. Being able to track such people, even when deep inside a building, provides an important enhancement to command and control and to their personal safety. Typically, an LAES system is deployed temporarily at the scene of a fire or other emergency in a building. Licences may be required for user organization, ECC Report 167 [i.10] and ECC Report 170 [i.11]. Some individual location tracking devices may be able to operate within different kinds of location tracking systems, and therefore may meet (in different modes) the requirements of any or all of LT1, LT2 and LAES. The present document does not cover UWB transmitters whose authorization to operate depends solely on the tests set out in the present document and which are installed or used in flying models, aircraft and other forms of aviation. Furthermore, it does not cover LT1 UWB transmitters that are operated on board a road or rail vehicle running on a public network or highway.
SIST EN 302 065-2 V2.1.1:2017 is classified under the following ICS (International Classification for Standards) categories: 33.060.99 - Other equipment for radiocommunications. The ICS classification helps identify the subject area and facilitates finding related standards.
SIST EN 302 065-2 V2.1.1:2017 is associated with the following European legislation: EU Directives/Regulations: 1999/5/EC, 2014/53/EU. When a standard is cited in the Official Journal of the European Union, products manufactured in conformity with it benefit from a presumption of conformity with the essential requirements of the corresponding EU directive or regulation.
SIST EN 302 065-2 V2.1.1:2017 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.
Standards Content (Sample)
Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
HARMONISED EUROPEAN STANDARD
Short Range Devices (SRD) using
Ultra Wide Band technology (UWB);
Harmonised Standard covering the essential requirements
of article 3.2 of the Directive 2014/53/EU;
Part 2: Requirements for UWB location tracking
2 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
Reference
REN/ERM-TGUWB-139
Keywords
radio, regulation, SRD, testing, UWB
ETSI
650 Route des Lucioles
F-06921 Sophia Antipolis Cedex - FRANCE
Tel.: +33 4 92 94 42 00 Fax: +33 4 93 65 47 16
Siret N° 348 623 562 00017 - NAF 742 C
Association à but non lucratif enregistrée à la
Sous-Préfecture de Grasse (06) N° 7803/88
Important notice
The present document can be downloaded from:
http://www.etsi.org/standards-search
The present document may be made available in electronic versions and/or in print. The content of any electronic and/or
print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any
existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the
print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat.
Users of the present document should be aware that the document may be subject to revision or change of status.
Information on the current status of this and other ETSI documents is available at
https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx
If you find errors in the present document, please send your comment to one of the following services:
https://portal.etsi.org/People/CommiteeSupportStaff.aspx
Copyright Notification
No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying
and microfilm except as authorized by written permission of ETSI.
The content of the PDF version shall not be modified without the written authorization of ETSI.
The copyright and the foregoing restriction extend to reproduction in all media.
© European Telecommunications Standards Institute 2016.
All rights reserved.
TM TM TM
DECT , PLUGTESTS , UMTS and the ETSI logo are Trade Marks of ETSI registered for the benefit of its Members.
TM
3GPP and LTE™ are Trade Marks of ETSI registered for the benefit of its Members and
of the 3GPP Organizational Partners.
GSM® and the GSM logo are Trade Marks registered and owned by the GSM Association.
ETSI
3 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
Contents
Intellectual Property Rights . 7
Foreword . 7
Modal verbs terminology . 7
1 Scope . 8
2 References . 9
2.1 Normative references . 9
2.2 Informative references . 9
3 Definitions, symbols and abbreviations . 10
3.1 Definitions . 10
3.2 Symbols . 11
3.3 Abbreviations . 11
4 Technical requirements specifications . 11
4.1 Environmental conditions . 11
4.2 General . 11
4.3 Transmitter Conformance Requirements . 12
4.3.1 Operating Bandwidth . 12
4.3.1.1 Applicability. 12
4.3.1.2 Description . 12
4.3.1.3 Limits . 12
4.3.1.4 Conformance . 13
4.3.2 Maximum Value of Mean Power Spectral Density . 13
4.3.2.1 Applicability. 13
4.3.2.2 Description . 13
4.3.2.3 Limits . 13
4.3.2.4 Conformance . 14
4.3.3 Maximum value of peak power . 14
4.3.3.1 Applicability. 14
4.3.3.2 Description . 14
4.3.3.3 Limits . 14
4.3.3.4 Conformance . 15
4.3.4 Exterior Limits . 16
4.3.5 Total Power . 16
4.3.6 Other Emissions . 16
4.3.6.1 Applicability. 16
4.3.6.2 Description . 16
4.3.6.3 Limits . 16
4.3.6.4 Conformance . 17
4.3.7 Transmitter Unwanted Emissions . 17
4.4 Receiver Conformance Requirements . 17
4.4.1 Receiver Requirements . 17
4.4.2 Receiver spurious emissions . 17
4.4.2.1 Applicability. 17
4.4.2.2 Description . 17
4.4.2.3 Limits . 17
4.4.2.4 Conformance . 18
4.4.3 Receiver interference handling . 18
4.4.3.1 Applicability. 18
4.4.3.2 Description . 18
4.4.3.3 Limits . 18
4.4.3.4 Conformance . 18
4.5 Requirements for Spectrum Access . 18
4.5.1 Detect and Avoid (DAA) . 18
4.5.1.1 Applicability. 18
4.5.1.2 Description . 18
4.5.1.3 Limits . 18
ETSI
4 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
4.5.1.4 Conformance . 18
4.5.2 Listen-Before-Talk (LBT) . 19
4.5.3 Low Duty Cycle (LDC) . 19
4.5.3.1 Applicability. 19
4.5.3.2 Description . 19
4.5.3.3 Limits . 19
4.5.3.4 Conformance . 19
4.6 Antenna Requirements . 19
4.6.1 Characteristics and orientation . 19
4.6.1.1 Applicability. 19
4.6.1.2 Description . 19
4.6.1.3 Limits . 20
4.6.1.4 Conformance . 20
4.7 Other Requirements and Mitigation techniques . 20
4.7.1 Adaptive / Transmit Power Control (TPC) . 20
4.7.2 Activity Factor . 20
4.7.3 Frequency Domain Mitigation . 20
4.7.4 Shielding Effects . 20
4.7.5 Thermal Radiation . 20
4.7.6 Site Registration . 20
4.7.6.1 Applicability. 20
4.7.6.2 Description . 20
4.7.6.3 Limits . 20
4.7.6.4 Conformance . 20
5 Testing for compliance with technical requirements . 20
5.1 Environmental conditions for testing . 20
5.2 General conditions for testing . 21
5.2.1 Product information . 21
5.2.2 Requirements for the test modulation . 21
5.2.3 Test conditions, power supply and ambient temperatures . 21
5.2.4 Choice of equipment for test suites . 21
5.2.5 Multiple operating bandwidths and multiband equipment . 21
5.2.6 Testing of host connected equipment and plug-in radio devices . 21
5.3 Interpretation of the measurement results . 21
5.3.0 General . 21
5.3.1 Measurement uncertainty is equal to or less than maximum acceptable uncertainty . 21
5.3.2 Measurement uncertainty is greater than maximum acceptable uncertainty . 21
5.3.3 Emissions . 21
6 Conformance methods of measurement for transmitters . 22
6.1 Introduction . 22
6.2 Initial Measurement steps . 22
6.3 Radiated measurements . 22
6.3.1 General . 22
6.3.2 Test sites and general arrangements for measurements involving the use of radiated fields . 22
6.3.3 Guidance on the use of a radiation test site . 22
6.3.3.1 General . 22
6.3.3.2 Range length . 22
6.3.4 Coupling of signals . 22
6.3.5 Standard test methods . 22
6.3.5.1 Generic measurement method . 22
6.3.5.1.1 Calibrated setup . 22
6.3.5.1.2 Substitution method . 22
6.3.6 Standard calibration method . 22
6.4 Conducted measurements . 22
6.4.1 General Setup . 22
6.4.2 Specific Setup . 23
6.5 Conformance methods of measurement for transmitter . 23
6.5.1 General . 23
6.5.2 Method of measurements of the Ultra Wideband Emissions . 23
6.5.3 Operating Bandwidth . 23
ETSI
5 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
6.5.4 Mean power spectral density measurements . 23
6.5.5 Peak power measurements . 23
6.5.6 Exterior limit measurement. 23
6.5.7 Total Power . 23
6.5.8 Transmitter unwanted emissions . 24
6.6 Conformance methods of measurement for receiver . 24
6.6.1 Receiver spurious emissions . 24
6.6.2 Receiver interference handling . 24
6.7 Conformance test suites for spectrum access . 24
6.7.1 Detect and Avoid Mechanisms . 24
6.7.2 Listen Before Talk . 24
6.7.3 Low Duty Cycle . 24
6.8 Conformance test suites for antenna requirements . 24
6.9 Other Test Suites . 24
6.9.1 Transmit Power Control . 24
6.9.2 Activity Factor . 24
6.9.3 Frequency Domain Mitigation . 24
6.9.4 Shielding Effects . 25
6.9.5 Thermal Radiation . 25
6.9.6 Installation requirements / site registration . 25
Annex A (normative): Relationship between the present document and the essential
requirements of Directive 2014/53/EU . 26
Annex B (informative): Application form for testing . 28
B.1 Introduction . 28
B.2 General information as required by ETSI EN 302 065-2, clause 5.2.1 . 28
B.2.1 Type of equipment (stand-alone, combined, plug-in radio device, etc.) . 28
B.2.2 The nominal voltages of the stand-alone radio equipment or the nominal voltages of the combined
(host) equipment or test jig in case of plug-in devices . 28
B.3 Signal-related information as required by ETSI EN 302 065-2, clause 4.3 . 29
B.3.1 Introduction . 29
B.3.2 Operating Bandwidth(s) of the equipment . 29
B.3.3 The worst case mode for each of the following tests . 29
B.4 RX test Information as required by ETSI EN 302 06-2, clause 4.4 . 29
B.4.2 Performance criterion and level of performance . 29
B.4.4 Interfering signals . 29
B.5 Information on spectrum access techniques as required by ETSI EN 302 065-2, clause 4.5 . 30
B.5.1 Introduction . 30
B.5.2 Spectrum access . 30
B.6 Information on antenna requirements as required by ETSI EN 302 065-2, clause 4.6 . 30
B.6.1 Introduction . 30
B.6.2 Antenna Requirements . 30
B.7 Additional information provided by the applicant . 31
B.7.1 About the UUT . 31
B.7.2 Additional items and/or supporting equipment provided . 31
Annex C (normative): Equivalent mitigation techniques . 32
C.1 Equivalent mitigation techniques and LDC limits . 32
C.2 Test Procedure . 32
C.3 Limit . 32
Annex D (informative): Measurement antenna, preamplifier and cable specifications . 33
Annex E (informative): Bibliography . 34
ETSI
6 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
History . 35
ETSI
7 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
Intellectual Property Rights
IPRs essential or potentially essential to the present document may have been declared to ETSI. The information
pertaining to these essential IPRs, if any, is publicly available for ETSI members and non-members, and can be found
in ETSI SR 000 314: "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in
respect of ETSI standards", which is available from the ETSI Secretariat. Latest updates are available on the ETSI Web
server (https://ipr.etsi.org/).
Pursuant to the ETSI IPR Policy, no investigation, including IPR searches, has been carried out by ETSI. No guarantee
can be given as to the existence of other IPRs not referenced in ETSI SR 000 314 (or the updates on the ETSI Web
server) which are, or may be, or may become, essential to the present document.
Foreword
This draft Harmonised European Standard (EN) has been produced by ETSI Technical Committee Electromagnetic
compatibility and Radio spectrum Matters (ERM), and is now submitted for the combined Public Enquiry and Vote
phase of the ETSI standards EN Approval Procedure.
The present document has been prepared under the Commission's standardisation request C(2015) 5376 final [i.18] to
provide one voluntary means of conforming to the essential requirements of Directive 2014/53/EU on the harmonisation
of the laws of the Member States relating to the making available on the market of radio equipment and repealing
Directive 1999/5/EC [i.15].
Once the present document is cited in the Official Journal of the European Union under that Directive, compliance with
the normative clauses of the present document given in table A.1 confers, within the limits of the scope of the present
document, a presumption of conformity with the corresponding essential requirements of that Directive, and associated
EFTA regulations.
The present document is part 2 of a multi-part deliverable. Full details of the entire series can be found in part 1 [i.17].
Proposed national transposition dates
Date of latest announcement of this EN (doa): 3 months after ETSI publication
Date of latest publication of new National Standard
or endorsement of this EN (dop/e): 6 months after doa
Date of withdrawal of any conflicting National Standard (dow): 18 months after doa
Modal verbs terminology
In the present document "shall", "shall not", "should", "should not", "may", "need not", "will", "will not", "can" and
"cannot" are to be interpreted as described in clause 3.2 of the ETSI Drafting Rules (Verbal forms for the expression of
provisions).
"must" and "must not" are NOT allowed in ETSI deliverables except when used in direct citation.
ETSI
8 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
1 Scope
The present document applies to transceivers, transmitters and receivers utilizing Ultra WideBand (UWB) technologies
and used for location tracking purposes.
The present document applies to impulse, modified impulse and RF carrier based UWB communication technologies.
The present document applies to fixed, mobile or portable applications, e.g. the present document applies to the
following equipment types:
• stand-alone radio equipment with or without its own control provisions;
• plug-in radio devices intended for use with, or within, a variety of host systems, e.g. personal computers, hand-
held terminals, etc.;
• plug-in radio devices intended for use within combined equipment, e.g. cable modems, set-top boxes, access
points, etc.;
• combined equipment or a combination of a plug-in radio device and a specific type of host equipment.
The present document applies to UWB equipment with an output connection used with a dedicated antenna or UWB
equipment with an integral antenna.
The present document covers three different types of location tracking system, which may use either of the UWB
technologies listed previously:
• LT1 systems: These systems, operating in the 6 GHz to 9 GHz region (see CEPT Report 45 [i.13]), are
intended for general location tracking of people and objects. They operate on an unlicensed basis. The
transmitting terminals in these systems are mobile (indoors or outdoors), or fixed (indoors only). Fixed
outdoor LT1 transmitters are not permitted. Typically, LT1 transmitters are mobile location tracking tags
which are attached to people or objects, and tags are tracked using a fixed receiver infrastructure to only
receive the UWB emission emitted by the tags, ETSI EG 201 399 [i.1].
• LT2 systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)09 [i.8]), are
intended for person and object tracking and industrial applications at well-defined locations. The transmitting
terminals in these systems may be located indoors or outdoors, and may be fixed or mobile. They operate at
fixed sites and may be subject to registration and authorization, provided local coordination with possible
interference victims has been performed, ECC Report 167 [i.10] and ECC Report 170 [i.11].
• LAES systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)10 [i.9]), are
intended for tracking staff belonging to the fire and other emergency services, who need to work in dangerous
situations. Being able to track such people, even when deep inside a building, provides an important
enhancement to command and control and to their personal safety. Typically, an LAES system is deployed
temporarily at the scene of a fire or other emergency in a building. Licences may be required for user
organization, ECC Report 167 [i.10] and ECC Report 170 [i.11].
Some individual location tracking devices may be able to operate within different kinds of location tracking systems,
and therefore may meet (in different modes) the requirements of any or all of LT1, LT2 and LAES.
The present document does not cover UWB transmitters whose authorization to operate depends solely on the tests set
out in the present document and which are installed or used in flying models, aircraft and other forms of aviation.
Furthermore, it does not cover LT1 UWB transmitters that are operated on board a road or rail vehicle running on a
public network or highway.
The permitted frequency ranges of operation for the various device types covered by the present document are given in
table 1.
ETSI
9 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
Table 1: Operating frequency bands
Device Mode Permitted range of operation Intended range of operation
type (preferred range of Operational Bandwidth)
(see note 1)
Transmit 30 MHz to 10,6 GHz (note 2) 6,0 GHz to 9 GHz
LT1
Receive 30 MHz to 10,6 GHz 6,0 GHz to 9 GHz
Transmit 30 MHz to 10,6 GHz (note 3) 3,1 GHz to 4,8 GHz
LAES
Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz
Transmit 30 MHz to 10,6 GHz (note 4) 3,1 GHz to 4,8 GHz
LT2
Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz
NOTE 1: This is the preferred range for the operating bandwidth, as defined in clause 4.3.1.
NOTE 2: Limits in table 2 (clause 4.3.2.3) and table 5 (clause 4.3.3.3) are to be met.
NOTE 3: Limits in table 3 (clause 4.3.2.3) and table 6 (clause 4.3.3.3) are to be met.
NOTE 4: Limits in table 4 (clause 4.3.2.3) and table 7 (clause 4.3.3.3) are to be met.
2 References
2.1 Normative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
Referenced documents which are not found to be publicly available in the expected location might be found at
http://docbox.etsi.org/Reference.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are necessary for the application of the present document.
[1] ETSI TS 102 754 (V1.3.1) (03-2013): "Electromagnetic compatibility and Radio spectrum Matters
(ERM); Short Range Devices (SRD); Technical characteristics of Detect And Avoid (DAA)
mitigation techniques for SRD equipment using Ultra Wideband (UWB) technology".
[2] ETSI EN 303 883 (V1.1.0) (02-2016): "Short Range Devices (SRD) using Ultra Wide Band
(UWB); Measurement Techniques".
[3] ETSI TS 103 361 (V1.1.1) (03-2016): "Short Range Devices (SRD) using Ultra Wide Band
technology (UWB); Receiver technical requirements, parameters and measurement procedures to
fulfil the requirements of the Directive 2014/53/EU".
[4] Void.
2.2 Informative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are not necessary for the application of the present document but they assist the
user with regard to a particular subject area.
[i.1] ETSI EG 201 399 (V2.1.1): "Electromagnetic compatibility and Radio spectrum Matters (ERM);
A guide to the production of candidate Harmonized Standards for application under the R&TTE
Directive".
[i.2] Void.
ETSI
10 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
[i.3] Void.
[i.4] CEPT ECC/DEC/(06)04 of 24 March 2006 amended 9 December 2011: "The harmonised
conditions for devices using Ultra-Wideband (UWB) technology in bands below 10.6 GHz".
[i.5] Commission Decision 2007/131/EC of 21 February 2007 on allowing the use of the radio
spectrum for equipment using ultra-wideband technology in a harmonised manner in the
Community (notified under document number C(2007) 522).
[i.6] ECC Report 120 (March 2008): "ECC Report on Technical requirements for UWB DAA (Detect
and avoid) devices to ensure the protection of radiolocation in the bands 3.1-3.4 GHz and
8.5-9 GHz and BWA terminals in the band 3.4 - 4.2 GHz".
[i.7] Void.
[i.8] ECC Recommendation (11)09 on UWB Location Tracking Systems Type 2 (LT2), October 2011.
[i.9] ECC Recommendation (11)10 on Location Tracking Application for Emergency and Disaster
Situations, October 2011.
[i.10] ECC Report 167 (May 2011): "The Practical Implementation of Registration/Coordination
Mechanism for UWB LT2 (Location Tracking Type 2) Systems".
[i.11] ECC Report 170 (October 2011): "ECC Report on Specific UWB Applications in the Bands 3.4 -
4.8 GHz and 6 - 8.5 GHz Location Tracking Applications for Emergency Services (LAES),
Location Tracking Applications Type 2 (LT2) and Location Tracking and Sensor Applications for
Automotive and Transportation Environments (LTA)".
[i.12] Void.
[i.13] CEPT Report 45: "Report from CEPT to the European Commission in response to the Fifth
Mandate to CEPT on ultra-wideband technology to clarify the technical parameters in view of a
potential update of Commission Decision 2007/131/EC; Report approved on 21 June 2013 by the
ECC".
[i.14] Commission Decision 2014/702/EU of 7 October 2014 amending Decision 2007/131/EC on
allowing the use of the radio spectrum for equipment using ultra-wideband technology in a
harmonised manner in the Community (notified under document C(2014) 7083).
[i.15] Directive 2014/53/EU of the European Parliament and of the Council of 16 April 2014 on the
harmonisation of the laws of the Member States relating to the making available on the market of
radio equipment and repealing Directive 1999/5/EC.
[i.16] Directive 1999/5/EC of the European Parliament and of the Council of 9 March 1999 on radio
equipment and telecommunications terminal equipment and the mutual recognition of their
conformity (R&TTE Directive).
[i.17] ETSI EN 302 065-1 (V.2.1.0): "Short Range Devices (SRD) using Ultra Wide Band technology
(UWB); Harmonised Standard covering the essential requirements of article 3.2 of the
Directive 2014/53/EU; Part 1: Requirements for Generic UWB applications".
[i.18] Commission Implementing Decision C(2015) 5376 final of 4.8.2015 on a standardisation request
to the European Committee for Electrotechnical Standardisation and to the European
Telecommunications Standards Institute as regards radio equipment in support of
Directive 2014/53/EU of the European Parliament and of the Council.
3 Definitions, symbols and abbreviations
3.1 Definitions
For the purposes of the present document, the definitions given in ETSI EN 303 883 [2] and the following apply:
transmitter off time: time interval between two consecutive bursts when the UWB emission is kept idle
ETSI
11 Draft ETSI EN 302 065-2 V2.1.0 (2016-04)
transmitter on time: duration of a burst irrespective of the number of pulses contained
3.2 Symbols
For the purposes of the present document, the symbols given in ETSI EN 303 883 [2] and the following apply:
d distance
k coverage factor
ϕ azimuth angle
Toff transmitter off time
Ton transmitter on time
3.3 Abbreviations
For the purposes of the present document, the abbreviations given in ETSI EN 303 883 [2] and the following apply:
CEPT European Conference of Postal and Telecommunications Administrations
NF Noise Figure
4 Technical requirements specifications
4.1 Environmental conditions
The technical requirements of the present document apply under the environmental profile for operation of the
equipment, which shall be declared by the supplier. The equipment shall comply with all the technical requirements of
the present document at all times when operating within the boundary limits of the declared operational environmental
profile.
The normal test conditions are defined in clause 5.4.3 of ETSI EN 303 883 [2].
4.2 General
UWB devices in the scope of the present document can operate in a broad permitted range of frequencies from 30 MHz
to 10,6 GHz, as defined in table 1 of the present document. The intended range of operation gives the preferred range of
operating frequencies for the UWB operation based on the allowed spectrum mask with increase permitted emission
levels in the intended range of operation. In order to clearly identify the required limits and thus measurement
procedures it is essential to define the operating bandwidth of the UWB equipment under test, The operating bandwidth
of the UWB equipment under test shall be the -10 dBc bandwidth of the intended UWB signal under normal operational
conditions as defined in ETSI EN 303 883 [2], clause 5.4.3. A single UWB device can have more than one operating
bandwidth.
The basic concept is depicted in figure 1. Here two separate operating bandwidths are depicted, one with a UWB
operating bandwidth in the lower frequency range and one in the upper frequency range. All UWB related emissions
shall be measured in the identified operating bandwidth of the UWB device under test. The required mitigation
techniques are only valid in the operating bandwidth.
The RX interference signal handling is focused in the operating bandwidth and some clearly identified frequencies
outside the operating bandwidth(s).
The operating bandwidth(s) is/are parts of the permitted range of operation, see table 1.
The test of required mitigation techniques are only relevant inside the operating bandwidth(s).
RX interference signal handling on the operating bandwidth and at defined frequencies below and above the operating
range limits.
TE: Total emission including UWB emission (mean power spectral density) and Other Emissions (OE) (e.g. RX
spurious, TX spuriou
...
HARMONISED EUROPEAN STANDARD
Short Range Devices (SRD) using
Ultra Wide Band technology (UWB);
Harmonised Standard covering the essential requirements
of article 3.2 of the Directive 2014/53/EU;
Part 2: Requirements for UWB location tracking
2 ETSI EN 302 065-2 V2.1.1 (2016-11)
Reference
REN/ERM-TGUWB-139
Keywords
harmonised standard, radio, regulation, SRD,
testing, UWB
ETSI
650 Route des Lucioles
F-06921 Sophia Antipolis Cedex - FRANCE
Tel.: +33 4 92 94 42 00 Fax: +33 4 93 65 47 16
Siret N° 348 623 562 00017 - NAF 742 C
Association à but non lucratif enregistrée à la
Sous-Préfecture de Grasse (06) N° 7803/88
Important notice
The present document can be downloaded from:
http://www.etsi.org/standards-search
The present document may be made available in electronic versions and/or in print. The content of any electronic and/or
print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any
existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the
print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat.
Users of the present document should be aware that the document may be subject to revision or change of status.
Information on the current status of this and other ETSI documents is available at
https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx
If you find errors in the present document, please send your comment to one of the following services:
https://portal.etsi.org/People/CommiteeSupportStaff.aspx
Copyright Notification
No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying
and microfilm except as authorized by written permission of ETSI.
The content of the PDF version shall not be modified without the written authorization of ETSI.
The copyright and the foregoing restriction extend to reproduction in all media.
© European Telecommunications Standards Institute 2016.
All rights reserved.
TM TM TM
DECT , PLUGTESTS , UMTS and the ETSI logo are Trade Marks of ETSI registered for the benefit of its Members.
TM
3GPP and LTE™ are Trade Marks of ETSI registered for the benefit of its Members and
of the 3GPP Organizational Partners.
GSM® and the GSM logo are Trade Marks registered and owned by the GSM Association.
ETSI
3 ETSI EN 302 065-2 V2.1.1 (2016-11)
Contents
Intellectual Property Rights . 7
Foreword . 7
Modal verbs terminology . 7
1 Scope . 8
2 References . 9
2.1 Normative references . 9
2.2 Informative references . 9
3 Definitions, symbols and abbreviations . 11
3.1 Definitions . 11
3.2 Symbols . 11
3.3 Abbreviations . 11
4 Technical requirements specifications . 11
4.1 Environmental conditions . 11
4.2 General . 11
4.3 Transmitter Conformance Requirements . 12
4.3.1 Operating Bandwidth . 12
4.3.1.1 Applicability. 12
4.3.1.2 Description . 13
4.3.1.3 Limits . 13
4.3.1.4 Conformance . 13
4.3.2 Maximum Value of Mean Power Spectral Density . 13
4.3.2.1 Applicability. 13
4.3.2.2 Description . 13
4.3.2.3 Limits . 13
4.3.2.4 Conformance . 14
4.3.3 Maximum value of peak power . 15
4.3.3.1 Applicability. 15
4.3.3.2 Description . 15
4.3.3.3 Limits . 15
4.3.3.4 Conformance . 16
4.3.4 Exterior Limits . 16
4.3.5 Total Power . 16
4.3.6 Other Emissions . 16
4.3.6.1 Applicability. 16
4.3.6.2 Description . 16
4.3.6.3 Limits . 17
4.3.6.4 Conformance . 17
4.3.7 Transmitter Unwanted Emissions . 17
4.4 Receiver Conformance Requirements . 17
4.4.1 General . 17
4.4.2 Receiver spurious emissions . 18
4.4.2.1 Applicability. 18
4.4.2.2 Description . 18
4.4.2.3 Limits . 18
4.4.2.4 Conformance . 18
4.4.3 Receiver interference handling . 18
4.4.3.1 Applicability. 18
4.4.3.2 Description . 18
4.4.3.3 Limits . 19
4.4.3.4 Conformance . 19
4.5 Requirements for Spectrum Access . 19
4.5.1 Detect and Avoid (DAA) . 19
4.5.1.1 Applicability. 19
4.5.1.2 Description . 19
ETSI
4 ETSI EN 302 065-2 V2.1.1 (2016-11)
4.5.1.3 Limits . 19
4.5.1.4 Conformance . 19
4.5.2 Listen-Before-Talk (LBT) . 19
4.5.3 Low Duty Cycle (LDC) . 19
4.5.3.1 Applicability. 19
4.5.3.2 Description . 19
4.5.3.3 Limits . 20
4.5.3.4 Conformance . 20
4.6 Antenna Requirements . 20
4.6.1 Characteristics and orientation . 20
4.6.1.1 Applicability. 20
4.6.1.2 Description . 20
4.6.1.3 Limits . 20
4.6.1.4 Conformance . 20
4.7 Other Requirements and Mitigation techniques . 21
4.7.1 Adaptive / Transmit Power Control (TPC) . 21
4.7.2 Activity Factor . 21
4.7.3 Frequency Domain Mitigation . 21
4.7.4 Shielding Effects . 21
4.7.5 Thermal Radiation . 21
4.7.6 Site Registration . 21
4.7.6.1 Applicability. 21
4.7.6.2 Description . 21
4.7.6.3 Limits . 21
4.7.6.4 Conformance . 21
5 Testing for compliance with technical requirements . 21
5.1 Environmental conditions for testing . 21
5.2 General conditions for testing . 22
5.2.1 Product information . 22
5.2.2 Requirements for the test modulation . 22
5.2.3 Test conditions, power supply and ambient temperatures . 22
5.2.4 Choice of equipment for test suites . 22
5.2.5 Multiple operating bandwidths and multiband equipment . 22
5.2.6 Testing of host connected equipment and plug-in radio devices . 22
5.3 Interpretation of the measurement results . 22
5.3.0 General . 22
5.3.1 Measurement uncertainty is equal to or less than maximum acceptable uncertainty . 22
5.3.2 Measurement uncertainty is greater than maximum acceptable uncertainty . 22
5.3.3 Emissions . 22
6 Conformance methods of measurement for transmitters . 23
6.1 Introduction . 23
6.2 Initial Measurement steps . 23
6.3 Radiated measurements . 23
6.3.1 General . 23
6.3.2 Test sites and general arrangements for measurements involving the use of radiated fields . 23
6.3.3 Guidance on the use of a radiation test site . 23
6.3.3.1 General . 23
6.3.3.2 Range length . 23
6.3.4 Coupling of signals . 23
6.3.5 Standard test methods . 23
6.3.5.1 Generic measurement method . 23
6.3.5.1.1 Calibrated setup . 23
6.3.5.1.2 Substitution method . 23
6.3.6 Standard calibration method . 24
6.4 Conducted measurements . 24
6.4.1 General Setup . 24
6.4.2 Specific Setup . 24
6.5 Conformance methods of measurement for transmitter . 24
6.5.1 General . 24
6.5.2 Method of measurements of the Ultra Wideband Emissions . 24
ETSI
5 ETSI EN 302 065-2 V2.1.1 (2016-11)
6.5.3 Operating Bandwidth . 24
6.5.4 Mean power spectral density measurements . 24
6.5.5 Peak power measurements . 25
6.5.6 Exterior limit measurement. 25
6.5.7 Total Power . 25
6.5.8 Transmitter unwanted emissions . 25
6.6 Conformance methods of measurement for receiver . 25
6.6.1 Receiver spurious emissions . 25
6.6.2 Receiver interference handling . 25
6.7 Conformance test suites for spectrum access . 25
6.7.1 Detect and Avoid Mechanisms . 25
6.7.2 Listen Before Talk . 25
6.7.3 Low Duty Cycle . 25
6.8 Conformance test suites for antenna requirements . 26
6.9 Other Test Suites . 26
6.9.1 Transmit Power Control . 26
6.9.2 Activity Factor . 26
6.9.3 Frequency Domain Mitigation . 26
6.9.4 Shielding Effects . 26
6.9.5 Thermal Radiation . 26
6.9.6 Installation requirements / site registration . 26
Annex A (normative): Relationship between the present document and the essential
requirements of Directive 2014/53/EU . 27
Annex B (informative): Application form for testing . 29
B.1 Introduction . 29
B.2 General information as required by ETSI EN 302 065-2, clause 5.2.1 . 29
B.2.1 Type of equipment (stand-alone, combined, plug-in radio device, etc.) . 29
B.2.2 The nominal voltages of the stand-alone radio equipment or the nominal voltages of the combined
(host) equipment or test jig in case of plug-in devices . 29
B.3 Signal-related information as required by ETSI EN 302 065-2, clause 4.3 . 30
B.3.1 Introduction . 30
B.3.2 Operating Bandwidth(s) of the equipment . 30
B.3.3 The worst case mode for each of the following tests . 30
B.4 RX test Information as required by ETSI EN 302 06-2, clause 4.4 . 30
B.4.2 Performance criterion and level of performance . 30
B.4.4 Interfering signals . 30
B.5 Information on spectrum access techniques as required by ETSI EN 302 065-2, clause 4.5 . 31
B.5.1 Introduction . 31
B.5.2 Spectrum access . 31
B.6 Information on antenna requirements as required by ETSI EN 302 065-2, clause 4.6 . 31
B.6.1 Introduction . 31
B.6.2 Antenna Requirements . 31
B.7 Additional information provided by the applicant . 32
B.7.1 About the UUT . 32
B.7.2 Additional items and/or supporting equipment provided . 32
Annex C (normative): Equivalent mitigation techniques . 33
C.1 Equivalent mitigation techniques and LDC limits . 33
C.2 Test Procedure . 33
C.3 Limit . 33
Annex D (informative): Measurement antenna, preamplifier and cable specifications . 34
Annex E (informative): Bibliography . 35
ETSI
6 ETSI EN 302 065-2 V2.1.1 (2016-11)
Annex F (informative): Change history . 36
History . 37
ETSI
7 ETSI EN 302 065-2 V2.1.1 (2016-11)
Intellectual Property Rights
IPRs essential or potentially essential to the present document may have been declared to ETSI. The information
pertaining to these essential IPRs, if any, is publicly available for ETSI members and non-members, and can be found
in ETSI SR 000 314: "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in
respect of ETSI standards", which is available from the ETSI Secretariat. Latest updates are available on the ETSI Web
server (https://ipr.etsi.org/).
Pursuant to the ETSI IPR Policy, no investigation, including IPR searches, has been carried out by ETSI. No guarantee
can be given as to the existence of other IPRs not referenced in ETSI SR 000 314 (or the updates on the ETSI Web
server) which are, or may be, or may become, essential to the present document.
Foreword
This Harmonised European Standard (EN) has been produced by ETSI Technical Committee Electromagnetic
compatibility and Radio spectrum Matters (ERM).
The present document has been prepared under the Commission's standardisation request C(2015) 5376 final [i.18] to
provide one voluntary means of conforming to the essential requirements of Directive 2014/53/EU on the harmonisation
of the laws of the Member States relating to the making available on the market of radio equipment and repealing
Directive 1999/5/EC [i.15].
Once the present document is cited in the Official Journal of the European Union under that Directive, compliance with
the normative clauses of the present document given in table A.1 confers, within the limits of the scope of the present
document, a presumption of conformity with the corresponding essential requirements of that Directive, and associated
EFTA regulations.
The present document is part 2 of a multi-part deliverable. Full details of the entire series can be found in part 1 [i.17].
National transposition dates
Date of adoption of this EN: 18 July 2016
Date of latest announcement of this EN (doa): 31 October 2016
Date of latest publication of new National Standard
or endorsement of this EN (dop/e): 30 April 2017
Date of withdrawal of any conflicting National Standard (dow): 30 April 2018
Modal verbs terminology
In the present document "shall", "shall not", "should", "should not", "may", "need not", "will", "will not", "can" and
"cannot" are to be interpreted as described in clause 3.2 of the ETSI Drafting Rules (Verbal forms for the expression of
provisions).
"must" and "must not" are NOT allowed in ETSI deliverables except when used in direct citation.
ETSI
8 ETSI EN 302 065-2 V2.1.1 (2016-11)
1 Scope
The present document applies to transceivers, transmitters and receivers utilizing Ultra WideBand (UWB) technologies
and used for location tracking purposes.
The present document applies to impulse, modified impulse and RF carrier based UWB communication technologies.
The present document applies to fixed, mobile or portable applications, e.g. the present document applies to the
following equipment types:
• stand-alone radio equipment with or without its own control provisions;
• plug-in radio devices intended for use with, or within, a variety of host systems, e.g. personal computers, hand-
held terminals, etc.;
• plug-in radio devices intended for use within combined equipment, e.g. cable modems, set-top boxes, access
points, etc.;
• combined equipment or a combination of a plug-in radio device and a specific type of host equipment.
The present document applies to UWB equipment with an output connection used with a dedicated antenna or UWB
equipment with an integral antenna.
The present document covers three different types of location tracking system, which may use either of the UWB
technologies listed previously:
• LT1 systems: These systems, operating in the 6 GHz to 9 GHz region (see CEPT Report 45 [i.13]), are
intended for general location tracking of people and objects. They operate on an unlicensed basis. The
transmitting terminals in these systems are mobile (indoors or outdoors), or fixed (indoors only). Fixed
outdoor LT1 transmitters are not permitted. Typically, LT1 transmitters are mobile location tracking tags
which are attached to people or objects, and tags are tracked using a fixed receiver infrastructure to only
receive the UWB emission emitted by the tags, ETSI EG 201 399 [i.1].
• LT2 systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)09 [i.8]), are
intended for person and object tracking and industrial applications at well-defined locations. The transmitting
terminals in these systems may be located indoors or outdoors, and may be fixed or mobile. They operate at
fixed sites and may be subject to registration and authorization, provided local coordination with possible
interference victims has been performed, ECC Report 167 [i.10] and ECC Report 170 [i.11].
• LAES systems: These systems, operating in the 3,1 GHz to 4,8 GHz region (see ECC/REC(11)10 [i.9]), are
intended for tracking staff belonging to the fire and other emergency services, who need to work in dangerous
situations. Being able to track such people, even when deep inside a building, provides an important
enhancement to command and control and to their personal safety. Typically, an LAES system is deployed
temporarily at the scene of a fire or other emergency in a building. Licences may be required for user
organization, ECC Report 167 [i.10] and ECC Report 170 [i.11].
Some individual location tracking devices may be able to operate within different kinds of location tracking systems,
and therefore may meet (in different modes) the requirements of any or all of LT1, LT2 and LAES.
The present document does not cover UWB transmitters whose authorization to operate depends solely on the tests set
out in the present document and which are installed or used in flying models, aircraft and other forms of aviation.
Furthermore, it does not cover LT1 UWB transmitters that are operated on board a road or rail vehicle running on a
public network or highway.
The permitted frequency ranges of operation for the various device types covered by the present document are given in
table 1.
ETSI
9 ETSI EN 302 065-2 V2.1.1 (2016-11)
Table 1: Operating frequency bands
Device Mode Permitted range of operation Intended range of operation
type (preferred range of Operational Bandwidth)
(see note 1)
Transmit 30 MHz to 10,6 GHz (note 2) 6,0 GHz to 9 GHz
LT1
Receive 30 MHz to 10,6 GHz 6,0 GHz to 9 GHz
Transmit 30 MHz to 10,6 GHz (note 3) 3,1 GHz to 4,8 GHz
LAES
Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz
Transmit 30 MHz to 10,6 GHz (note 4) 3,1 GHz to 4,8 GHz
LT2
Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz
NOTE 1: This is the preferred range for the operating bandwidth, as defined in clause 4.3.1.
NOTE 2: Limits in table 2 (clause 4.3.2.3) and table 5 (clause 4.3.3.3) are to be met.
NOTE 3: Limits in table 3 (clause 4.3.2.3) and table 6 (clause 4.3.3.3) are to be met.
NOTE 4: Limits in table 4 (clause 4.3.2.3) and table 7 (clause 4.3.3.3) are to be met.
2 References
2.1 Normative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
Referenced documents which are not found to be publicly available in the expected location might be found at
http://docbox.etsi.org/Reference.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are necessary for the application of the present document.
[1] ETSI TS 102 754 (V1.3.1) (03-2013): "Electromagnetic compatibility and Radio spectrum Matters
(ERM); Short Range Devices (SRD); Technical characteristics of Detect And Avoid (DAA)
mitigation techniques for SRD equipment using Ultra Wideband (UWB) technology".
[2] ETSI EN 303 883 (V1.1.1) (09-2016): "Short Range Devices (SRD) using Ultra Wide Band
(UWB); Measurement Techniques".
[3] ETSI TS 103 361 (V1.1.1) (03-2016): "Short Range Devices (SRD) using Ultra Wide Band
technology (UWB); Receiver technical requirements, parameters and measurement procedures to
fulfil the requirements of the Directive 2014/53/EU".
[4] Void.
2.2 Informative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are not necessary for the application of the present document but they assist the
user with regard to a particular subject area.
[i.1] ETSI EG 201 399 (V2.1.1): "Electromagnetic compatibility and Radio spectrum Matters (ERM);
A guide to the production of candidate Harmonized Standards for application under the R&TTE
Directive".
ETSI
10 ETSI EN 302 065-2 V2.1.1 (2016-11)
[i.2] Void.
[i.3] Void.
[i.4] CEPT ECC/DEC/(06)04 of 24 March 2006 amended 9 December 2011: "The harmonised
conditions for devices using Ultra-Wideband (UWB) technology in bands below 10.6 GHz".
[i.5] Commission Decision 2007/131/EC of 21 February 2007 on allowing the use of the radio
spectrum for equipment using ultra-wideband technology in a harmonised manner in the
Community (notified under document number C(2007) 522).
[i.6] ECC Report 120 (March 2008): "ECC Report on Technical requirements for UWB DAA (Detect
and avoid) devices to ensure the protection of radiolocation in the bands 3.1-3.4 GHz and
8.5-9 GHz and BWA terminals in the band 3.4 - 4.2 GHz".
[i.7] Void.
[i.8] ECC Recommendation (11)09 on UWB Location Tracking Systems Type 2 (LT2), October 2011.
[i.9] ECC Recommendation (11)10 on Location Tracking Application for Emergency and Disaster
Situations, October 2011.
[i.10] ECC Report 167 (May 2011): "The Practical Implementation of Registration/Coordination
Mechanism for UWB LT2 (Location Tracking Type 2) Systems".
[i.11] ECC Report 170 (October 2011): "ECC Report on Specific UWB Applications in the Bands 3.4 -
4.8 GHz and 6 - 8.5 GHz Location Tracking Applications for Emergency Services (LAES),
Location Tracking Applications Type 2 (LT2) and Location Tracking and Sensor Applications for
Automotive and Transportation Environments (LTA)".
[i.12] Void.
[i.13] CEPT Report 45: "Report from CEPT to the European Commission in response to the Fifth
Mandate to CEPT on ultra-wideband technology to clarify the technical parameters in view of a
potential update of Commission Decision 2007/131/EC; Report approved on 21 June 2013 by the
ECC".
[i.14] Commission Decision 2014/702/EU of 7 October 2014 amending Decision 2007/131/EC on
allowing the use of the radio spectrum for equipment using ultra-wideband technology in a
harmonised manner in the Community (notified under document C(2014) 7083).
[i.15] Directive 2014/53/EU of the European Parliament and of the Council of 16 April 2014 on the
harmonisation of the laws of the Member States relating to the making available on the market of
radio equipment and repealing Directive 1999/5/EC.
[i.16] Directive 1999/5/EC of the European Parliament and of the Council of 9 March 1999 on radio
equipment and telecommunications terminal equipment and the mutual recognition of their
conformity (R&TTE Directive).
[i.17] ETSI EN 302 065-1 (V.2.1.0): "Short Range Devices (SRD) using Ultra Wide Band technology
(UWB); Harmonised Standard covering the essential requirements of article 3.2 of the
Directive 2014/53/EU; Part 1: Requirements for Generic UWB applications".
[i.18] Commission Implementing Decision C(2015) 5376 final of 4.8.2015 on a standardisation request
to the European Committee for Electrotechnical Standardisation and to the European
Telecommunications Standards Institute as regards radio equipment in support of
Directive 2014/53/EU of the European Parliament and of the Council.
ETSI
11 ETSI EN 302 065-2 V2.1.1 (2016-11)
3 Definitions, symbols and abbreviations
3.1 Definitions
For the purposes of the present document, the definitions given in ETSI EN 303 883 [2] and the following apply:
transmitter off time: time interval between two consecutive bursts when the UWB emission is kept idle
transmitter on time: duration of a burst irrespective of the number of pulses contained
3.2 Symbols
For the purposes of the present document, the symbols given in ETSI EN 303 883 [2] and the following apply:
d distance
k coverage factor
ϕ azimuth angle
Toff transmitter off time
Ton transmitter on time
3.3 Abbreviations
For the purposes of the present document, the abbreviations given in ETSI EN 303 883 [2] and the following apply:
CEPT European Conference of Postal and Telecommunications Administrations
NF Noise Figure
4 Technical requirements specifications
4.1 Environmental conditions
The technical requirements of the present document apply under the environmental profile for operation of the
equipment, which shall be declared by the manufacturer. The equipment shall comply with all the technical
requirements of the present document at all times when operating within the boundary limits of the declared operational
environmental profile.
The normal test conditions are defined in clause 5.4.3 of ETSI EN 303 883 [2].
4.2 General
UWB devices in the scope of the present document can operate in a broad permitted range of frequencies from 30 MHz
to 10,6 GHz, as defined in table 1 of the present document. The intended range of operation gives the preferred range of
operating frequencies for the UWB operation based on the allowed spectrum mask with increase permitted emission
levels in the intended range of operation. In order to clearly identify the required limits and thus measurement
procedures it is essential to define the operating bandwidth of the UWB equipment under test, The operating bandwidth
of the UWB equipment under test shall be the -10 dBc bandwidth of the intended UWB signal under normal operational
conditions as defined in ETSI EN 303 883 [2], clause 5.4.3. A single UWB device can have more than one operating
bandwidth.
The basic concept is depicted in figure 1. Here two separate operating bandwidths are depicted, one with a UWB
operating bandwidth in the lower frequency range and one in the upper frequency range. All UWB related emissions
shall be measured in the identified operating bandwidth of the UWB device under test. The required mitigation
techniques are only valid in the operating bandwidth.
ETSI
12 ETSI EN 302 065-2 V2.1.1 (2016-11)
The RX interference signal handling is focused in the operating bandwidth and some clearly identified frequencies
outside the operating bandwidth(s).
The operating bandwidth(s) is/are parts of the permitted range of operation, see table 1.
The test of required mitigation techniques are only relevant inside the operating bandwidth(s).
RX interference signal handling on the operating bandwidth and at defined frequencies below and above the operating
range limits.
TE: Total emission
...
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.Short Range Devices (SRD) using Ultra Wide Band technology (UWB) - Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU - Part 2: Requirements for UWB location tracking33.060.99Druga oprema za radijske komunikacijeOther equipment for radiocommunicationsICS:Ta slovenski standard je istoveten z:ETSI EN 302 065-2 V2.1.1 (2016-11)SIST EN 302 065-2 V2.1.1:2017en01-januar-2017SIST EN 302 065-2 V2.1.1:2017SLOVENSKI
STANDARD
wwwwwETSI EN 302 065-2 V2.1.1 (2016-11) Short Range Devices (SRD) using
Ultra Wide Band technology (UWB);
Harmonised Standard covering the essential requirements of article 3.2 of the Directive 2014/53/EU; Part 2: Requirements for UWB location tracking
HARMONISED EUROPEAN STANDARD SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 2 wwwoeferencewREN/ERM-TGUWB-139 heywordswharmonised standard, radio, regulation, SRD, testing, UWB ETSI 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCEw Tel.: +33 4 92 94 42 00
Fax: +33 4 93 65 47 16
Siret N° 348 623 562 00017 - NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N° 7803/88
Important notice The present document can be downloaded from: http://www.etsi.org/standards-search The present document may be made available in electronic versions and/or in print. The content of any electronic and/or print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other ETSI documents is available at https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx If you find errors in the present document, please send your comment to one of the following services: https://portal.etsi.org/People/CommiteeSupportStaff.aspx Copyright Notification No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying and microfilm except as authorized by written permission of ETSI. The content of the PDF version shall not be modified without the written authorization of ETSI. The copyright and the foregoing restriction extend to reproduction in all media.
© European Telecommunications Standards Institute 2016. All rights reserved.
DECTTM, PLUGTESTSTM, UMTSTM and the ETSI logo are Trade Marks of ETSI registered for the benefit of its Members. 3GPPTM and LTE™ are Trade Marks of ETSI registered for the benefit of its Members and of the 3GPP Organizational Partners. GSM® and the GSM logo are Trade Marks registered and owned by the GSM Association. SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 3 Contents fntellectualwmropertywoightswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq corewordwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq jodalwverbswterminologywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq kwpcopewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwr lwoeferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws lhkwkormativewreferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws lhlwfnformativewreferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws mwaefinitionsfwsymbolswandwabbreviationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk mhkwaefinitionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk mhlwpymbolswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk mhmwAbbreviationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4wqechnicalwrequirementswspecificationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hkwbnvironmentalwconditionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hlwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hmwqransmitterwConformancewoequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkl 4hmhkwlperatingwBandwidthwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkl 4hmhkhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkl 4hmhkhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhkhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhkh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhlwjaximumwsaluewofwjeanwmowerwppectralwaensitywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhlhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhlhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhlhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkm 4hmhlh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwk4 4hmhmwjaximumwvaluewofwpeakwpowerwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko 4hmhmhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko 4hmhmhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko 4hmhmhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko 4hmhmh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmh4wbxteriorwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmhowqotalwmowerwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmhpwltherwbmissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmhphkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmhphlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp 4hmhphmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkq 4hmhph4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkq 4hmhqwqransmitterwrnwantedwbmissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkq 4h4woeceiverwConformancewoequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkq 4h4hkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkq 4h4hlwoeceiverwspuriouswemissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hlhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hlhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hlhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hlh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hmwoeceiverwinterferencewhandlingwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hmhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hmhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr 4h4hmhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4h4hmh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4howoequirementswforwppectrumwAccesswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohkwaetectwandwAvoidwbaAAcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohkhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohkhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 4 4hohkhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohkh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohlwiistengBeforegqalkwbiBqcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohmwiowwautywCyclewbiaCcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohmhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohmhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks 4hohmhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hohmh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hpwAntennawoequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hphkwCharacteristicswandworientationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hphkhkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hphkhlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hphkhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hphkh4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj 4hqwltherwoequirementswandwjitigationwtechniqueswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhkwAdaptivewiwqransmitwmowerwControlwbqmCcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhlwActivitywcactorwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhmwcrequencywaomainwjitigationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqh4wphieldingwbffectswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhowqhermalwoadiationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhpwpitewoegistrationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhphkwApplicabilityhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhphlwaescriptionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhphmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk 4hqhph4wConformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk owqestingwforwcompliancewwithwtechnicalwrequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk ohkwbnvironmentalwconditionswforwtestingwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk ohlwdeneralwconditionswforwtestingwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlhkwmroductwinformationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlhlwoequirementswforwthewtestwmodulationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlhmwqestwconditionsfwpowerwsupplywandwambientwtemperatureswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlh4wChoicewofwequipmentwforwtestwsuiteswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlhowjultiplewoperatingwbandwidthswandwmultibandwequipmentwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohlhpwqestingwofwhostwconnectedwequipmentwandwplugginwradiowdeviceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohmwfnterpretationwofwthewmeasurementwresultswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohmhjwwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohmhkwjeasurementwuncertaintywiswequalwtoworwlesswthanwmaximumwacceptablewuncertaintywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohmhlwjeasurementwuncertaintywiswgreaterwthanwmaximumwacceptablewuncertaintywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll ohmhmwbmissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll pwConformancewmethodswofwmeasurementwforwtransmitterswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phkwfntroductionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phlwfnitialwjeasurementwstepswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmwoadiatedwmeasurementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhlwqestwsiteswandwgeneralwarrangementswforwmeasurementswinvolvingwthewusewofwradiatedwfieldswhhhhhhhhhhhhhhhhhhhhhhwlm phmhmwduidancewonwthewusewofwawradiationwtestwsitewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhmhkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhmhlwoangewlengthwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmh4wCouplingwofwsignalswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhowptandardwtestwmethodswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhohkwdenericwmeasurementwmethodwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhohkhkwCalibratedwsetupwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhohkhlwpubstitutionwmethodwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm phmhpwptandardwcalibrationwmethodwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 ph4wConductedwmeasurementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 ph4hkwdeneralwpetupwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 ph4hlwppecificwpetupwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 phowConformancewmethodswofwmeasurementwforwtransmitterwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 phohkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 phohlwjethodwofwmeasurementswofwthewrltrawtidebandwbmissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 5 phohmwlperatingwBandwidthwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 phoh4wjeanwpowerwspectralwdensitywmeasurementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 phohowmeakwpowerwmeasurementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phohpwbxteriorwlimitwmeasurementhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phohqwqotalwmowerwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phohrwqransmitterwunwantedwemissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phpwConformancewmethodswofwmeasurementwforwreceiverwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phphkwoeceiverwspuriouswemissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phphlwoeceiverwinterferencewhandlingwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phqwConformancewtestwsuiteswforwspectrumwaccesswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phqhkwaetectwandwAvoidwjechanismswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phqhlwiistenwBeforewqalkwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phqhmwiowwautywCyclewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlo phrwConformancewtestwsuiteswforwantennawrequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phswltherwqestwpuiteswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phshkwqransmitwmowerwControlwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phshlwActivitywcactorwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phshmwcrequencywaomainwjitigationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phsh4wphieldingwbffectswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phshowqhermalwoadiationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp phshpwfnstallationwrequirementswiwsitewregistrationwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlp Annex A (normative): Relationship between the present document and the essential requirements of Directive 2014/53/EU . 27 Annex B (informative): Application form for testing . 29 Bhkwfntroductionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwls Bhlwdeneralwinformationwaswrequiredwbywbqpfwbkwmjlwjpoglfwclausewohlhkwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwls Bhlhkwqypewofwequipmentwbstandgalonefwcombinedfwplugginwradiowdevicefwetchcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwls Bhlhlwqhewnominalwvoltageswofwthewstandgalonewradiowequipmentworwthewnominalwvoltageswofwthewcombinedwbhostcwequipmentworwtestwjigwinwcasewofwplugginwdeviceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwls Bhmwpignalgrelatedwinformationwaswrequiredwbywbqpfwbkwmjlwjpoglfwclausew4hmwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bhmhkwfntroductionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj BhmhlwlperatingwBandwidthbscwofwthewequipmentwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bhmhmwqhewworstwcasewmodewforweachwofwthewfollowingwtestswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bh4wouwtestwfnformationwaswrequiredwbywbqpfwbkwmjlwjpglfwclausew4h4whhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bh4hlwmerformancewcriterionwandwlevelwofwperformancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bh4h4wfnterferingwsignalswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmj Bhowfnformationwonwspectrumwaccesswtechniqueswaswrequiredwbywbqpfwbkwmjlwjpoglfwclausew4howhhhhhhhhhhhhhhhhwmk Bhohkwfntroductionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmk Bhohlwppectrumwaccesswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmk Bhpwfnformationwonwantennawrequirementswaswrequiredwbywbqpfwbkwmjlwjpoglfwclausew4hpwhhhhhhhhhhhhhhhhhhhhhhhhhhwmk Bhphkwfntroductionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmk BhphlwAntennawoequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmk BhqwAdditionalwinformationwprovidedwbywthewapplicantwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwml BhqhkwAboutwthewrrqwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwml BhqhlwAdditionalwitemswandiorwsupportingwequipmentwprovidedwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwml Annex C (normative): Equivalent mitigation techniques . 33 ChkwbquivalentwmitigationwtechniqueswandwiaCwlimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmm Chlwqestwmrocedurewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmm Chmwiimitwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmm Annex D (informative): Measurement antenna, preamplifier and cable specifications . 34 Annex E (informative): Bibliography . 35 SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 6 Annex F (informative): Change history . 36 eistorywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmq ww SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 7 Intellectual Property Rights
fmoswessentialworwpotentiallywessentialwtowthewpresentwdocumentwmaywhavewbeenwdeclaredwtowbqpfhwqhewinformationwpertainingwtowthesewessentialwfmosfwifwanyfwiswpubliclywavailablewforwETSI members and non-membersfwandwcanwbewfoundwinwbqpfwpowjjjwmk4tw"Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in respect of ETSI standards"fwwhichwiswavailablewfromwthewbqpfwpecretariathwiatestwupdateswarewavailablewonwthewbqpfwtebwserverwbhttpstiiiprhetsihorgichwmursuantwtowthewbqpfwfmowmolicyfwnowinvestigationfwincludingwfmowsearchesfwhaswbeenwcarriedwoutwbywbqpfhwkowguaranteewcanwbewgivenwaswtowthewexistencewofwotherwfmoswnotwreferencedwinwbqpfwpowjjjwmk4wborwthewupdateswonwthewbqpfwtebwservercwwhichwarefworwmaywbefworwmaywbecomefwessentialwtowthewpresentwdocumenthwForeword
qhiswearmonisedwburopeanwptandardwbbkcwhaswbeenwproducedwbywbqpfwqechnicalwCommitteewblectromagneticwcompatibilitywandwoadiowspectrumwjatterswbbojchwqhewpresentwdocumentwhaswbeenwpreparedwunderwthewCommissionaswstandardisationwrequestwCbljkocwomqpwfinalwxihkrzwtowprovidewonewvoluntarywmeanswofwconformingwtowthewessentialwrequirementswofwairectivewljk4iomibrwonwthewharmonisationwofwthewlawswofwthewjemberwptateswrelatingwtowthewmakingwavailablewonwthewmarketwofwradiowequipmentwandwrepealingwairectivewksssioibCwxihkozhwlncewthewpresentwdocumentwiswcitedwinwthewlfficialwgournalwofwthewburopeanwrnionwunderwthatwairectivefwcompliancewwithwthewnormativewclauseswofwthewpresentwdocumentwgivenwinwtablewAhkwconfersfwwithinwthewlimitswofwthewscopewofwthewpresentwdocumentfwawpresumptionwofwconformitywwithwthewcorrespondingwessentialwrequirementswofwthatwairectivefwandwassociatedwbcqAwregulationshwqhewpresentwdocumentwiswpartwlwofwawmultigpartwdeliverablehwcullwdetailswofwthewentirewserieswcanwbewfoundwinwpartwkwxihkqzhwwNational transposition dates aatewofwadoptionwofwthiswbktwkrwgulywljkpwaatewofwlatestwannouncementwofwthiswbkwbdoactwmkwlctoberwljkpwaatewofwlatestwpublicationwofwnewwkationalwptandardworwendorsementwofwthiswbkwbdopiectwwmjwAprilwljkqwaatewofwwithdrawalwofwanywconflictingwkationalwptandardwbdowctwmjwAprilwljkrwwModal verbs terminology fnwthewpresentwdocumentw?shall?fw?shall not?fw?should?fw?should not?fw?may?fw?need not?fw?will?fw?will not?fw?can?wandw?cannot?warewtowbewinterpretedwaswdescribedwinwclausewmhlwofwthewbqpfwaraftingwouleswbserbalwformswforwthewexpressionwofwprovisionschw?must?wandw?must not?warewNOTwallowedwinwbqpfwdeliverableswexceptwwhenwusedwinwdirectwcitationhwSIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 8 1 Scope qhewpresentwdocumentwapplieswtowtransceiversfwtransmitterswandwreceiverswutilizingwrltrawtideBandwbrtBcwtechnologieswandwusedwforwlocationwtrackingwpurposeshwwqhewpresentwdocumentwapplieswtowimpulsefwmodifiedwimpulsewandwocwcarrierwbasedwrtBwcommunicationwtechnologieshwwqhewpresentwdocumentwapplieswtowfixedfwmobileworwportablewapplicationsfwehghwthewpresentwdocumentwapplieswtowthewfollowingwequipmentwtypestw• standgalonewradiowequipmentwwithworwwithoutwitswownwcontrolwprovisionsuw• plugginwradiowdeviceswintendedwforwusewwithfworwwithinfwawvarietywofwhostwsystemsfwehghwpersonalwcomputersfwhandgheldwterminalsfwetchuw• plugginwradiowdeviceswintendedwforwusewwithinwcombinedwequipmentfwehghwcablewmodemsfwsetgtopwboxesfwaccesswpointsfwetchuw• combinedwequipmentworwawcombinationwofwawplugginwradiowdevicewandwawspecificwtypewofwhostwequipmenthwqhewpresentwdocumentwapplieswtowrtBwequipmentwwithwanwoutputwconnectionwusedwwithwawdedicatedwantennaworwrtBwequipmentwwithwanwintegralwantennahwwqhewpresentwdocumentwcoverswthreewdifferentwtypeswofwlocationwtrackingwsystemfwwhichwmaywuseweitherwofwthewrtBwtechnologieswlistedwpreviouslytw• LT1 systemstwqhesewsystemsfwoperatingwinwthewpwdezwtowswdezwregionwbseewCbmqwoeportw4owxihkmzcfwarewintendedwforwgeneralwlocationwtrackingwofwpeoplewandwobjectshwqheywoperatewonwanwunlicensedwbasishwqhewtransmittingwterminalswinwthesewsystemswarewmobilewbindoorsworwoutdoorscfworwfixedwbindoorswonlychwcixedwoutdoorwiqkwtransmitterswarewnotwpermittedhwqypicallyfwiqkwtransmitterswarewmobilewlocationwtrackingwtagswwhichwarewattachedwtowpeopleworwobjectsfwandwtagswarewtrackedwusingwawfixedwreceiverwinfrastructurewtowonlywreceivewthewrtBwemissionwemittedwbywthewtagsfwbqpfwbdwljkwmsswxihkzhw• LT2 systemstwqhesewsystemsfwoperatingwinwthewmfkwdezwtow4frwdezwregionwbseewbCCiobCbkkcjswxihrzcfwarewintendedwforwpersonwandwobjectwtrackingwandwindustrialwapplicationswatwwellgdefinedwlocationshwqhewtransmittingwterminalswinwthesewsystemswmaywbewlocatedwindoorsworwoutdoorsfwandwmaywbewfixedworwmobilehwqheywoperatewatwfixedwsiteswandwmaywbewsubjectwtowregistrationwandwauthorizationfwprovidedwlocalwcoordinationwwithwpossiblewinterferencewvictimswhaswbeenwperformedfwbCCwoeportwkpqwxihkjzwandwbCCwoeportwkqjwxihkkzhw• LAES systemstwqhesewsystemsfwoperatingwinwthewmfkwdezwtow4frwdezwregionwbseewbCCiobCbkkckjwxihszcfwarewintendedwforwtrackingwstaffwbelongingwtowthewfirewandwotherwemergencywservicesfwwhowneedwtowworkwinwdangerouswsituationshwBeingwablewtowtrackwsuchwpeoplefwevenwwhenwdeepwinsidewawbuildingfwprovideswanwimportantwenhancementwtowcommandwandwcontrolwandwtowtheirwpersonalwsafetyhwqypicallyfwanwiAbpwsystemwiswdeployedwtemporarilywatwthewscenewofwawfireworwotherwemergencywinwawbuildinghwiicenceswmaywbewrequiredwforwuserworganizationfwbCCwoeportwkpqwxihkjzwandwbCCwoeportwkqjwxihkkzhwpomewindividualwlocationwtrackingwdeviceswmaywbewablewtowoperatewwithinwdifferentwkindswofwlocationwtrackingwsystemsfwandwthereforewmaywmeetwbinwdifferentwmodescwthewrequirementswofwanyworwallwofwiqkfwiqlwandwiAbphwwqhewpresentwdocumentwdoeswnotwcoverwrtBwtransmitterswwhosewauthorizationwtowoperatewdependswsolelywonwthewtestswsetwoutwinwthewpresentwdocumentwandwwhichwarewinstalledworwusedwinwflyingwmodelsfwaircraftwandwotherwformswofwaviationhwcurthermorefwitwdoeswnotwcoverwiqkwrtBwtransmitterswthatwarewoperatedwonwboardwawroadworwrailwvehiclewrunningwonwawpublicwnetworkworwhighwayhwwqhewpermittedwfrequencywrangeswofwoperationwforwthewvariouswdevicewtypeswcoveredwbywthewpresentwdocumentwarewgivenwinwtablewkhw SIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 9 Table 1: Operating frequency bands Device type Mode Permitted range of operation Intended range of operation
(preferred range of Operational Bandwidth) (see note 1) LT1 Transmit 30 MHz to 10,6 GHz (note 2) 6,0 GHz to 9 GHz Receive 30 MHz to 10,6 GHz 6,0 GHz to 9 GHz LAES Transmit 30 MHz to 10,6 GHz (note 3) 3,1 GHz to 4,8 GHz Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz LT2 Transmit 30 MHz to 10,6 GHz (note 4) 3,1 GHz to 4,8 GHz Receive 30 MHz to 10,6 GHz 3,1 GHz to 4,8 GHz NOTE 1: This is the preferred range for the operating bandwidth, as defined in clause 4.3.1. NOTE 2: Limits in table 2 (clause 4.3.2.3) and table 5 (clause 4.3.3.3) are to be met. NOTE 3: Limits in table 3 (clause 4.3.2.3) and table 6 (clause 4.3.3.3) are to be met. NOTE 4: Limits in table 4 (clause 4.3.2.3) and table 7 (clause 4.3.3.3) are to be met. w2 References 2.1 Normative references oeferenceswareweitherwspecificwbidentifiedwbywdatewofwpublicationwandiorweditionwnumberworwversionwnumbercworwnongspecifichwcorwspecificwreferencesfwonlywthewcitedwversionwapplieshwcorwnongspecificwreferencesfwthewlatestwversionwofwthewreferencedwdocumentwbincludingwanywamendmentscwapplieshwoeferencedwdocumentswwhichwarewnotwfoundwtowbewpubliclywavailablewinwthewexpectedwlocationwmightwbewfoundwatwhttptiidocboxhetsihorgioeferencehwklqbtwthilewanywhyperlinkswincludedwinwthiswclausewwerewvalidwatwthewtimewofwpublicationfwbqpfwcannotwguaranteewtheirwlongwtermwvalidityhwqhewfollowingwreferencedwdocumentswarewnecessarywforwthewapplicationwofwthewpresentwdocumenthwxkzwbqpfwqpwkjlwqo4wbskhmhkcwbjmgljkmctw?blectromagneticwcompatibilitywandwoadiowspectrumwjatterswbbojcuwphortwoangewaeviceswbpoacuwqechnicalwcharacteristicswofwaetectwAndwAvoidwbaAAcwmitigationwtechniqueswforwpoawequipmentwusingwrltrawtidebandwbrtBcwtechnology?hwxlzwbqpfwbkwmjmwrrmwbskhkhkcwbjsgljkpctw?phortwoangewaeviceswbpoacwusingwrltrawtidewBandwbrtBcuwjeasurementwqechniques?hwxmzwbqpfwqpwkjmwmpkwbskhkhkcwbjmgljkpctw?phortwoangewaeviceswbpoacwusingwrltrawtidewBandwtechnologywbrtBcuwoeceiverwtechnicalwrequirementsfwparameterswandwmeasurementwprocedureswtowfulfilwthewrequirementswofwthewairectivewljk4iomibr?hwx4zwsoidhw2.2 Informative references oeferenceswareweitherwspecificwbidentifiedwbywdatewofwpublicationwandiorweditionwnumberworwversionwnumbercworwnongspecifichwcorwspecificwreferencesfwonlywthewcitedwversionwapplieshwcorwnongspecificwreferencesfwthewlatestwversionwofwthewreferencedwdocumentwbincludingwanywamendmentscwapplieshwklqbtwthilewanywhyperlinkswincludedwinwthiswclausewwerewvalidwatwthewtimewofwpublicationfwbqpfwcannotwguaranteewtheirwlongwtermwvalidityhwqhewfollowingwreferencedwdocumentswarewnotwnecessarywforwthewapplicationwofwthewpresentwdocumentwbutwtheywassistwthewuserwwithwregardwtowawparticularwsubjectwareahwxihkzwbqpfwbdwljkwmsswbslhkhkctw?blectromagneticwcompatibilitywandwoadiowspectrumwjatterswbbojcuwAwguidewtowthewproductionwofwcandidatewearmonizedwptandardswforwapplicationwunderwthewoCqqbwairective?hwSIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 10 xihlzwsoidhwxihmzwsoidhwxih4zwCbmqwbCCiabCibjpcj4wofwl4wjarchwljjpwamendedwswaecemberwljkktw?qhewharmonisedwconditionswforwdeviceswusingwrltragtidebandwbrtBcwtechnologywinwbandswbelowwkjhpwdez?hwxihozwCommissionwaecisionwljjqikmkibCwofwlkwcebruarywljjqwonwallowingwthewusewofwthewradiowspectrumwforwequipmentwusingwultragwidebandwtechnologywinwawharmonisedwmannerwinwthewCommunitywbnotifiedwunderwdocumentwnumberwCbljjqcwollchwxihpzwbCCwoeportwkljwbjarchwljjrctw?bCCwoeportwonwqechnicalwrequirementswforwrtBwaAAwbaetectwandwavoidcwdeviceswtowensurewthewprotectionwofwradiolocationwinwthewbandswmhkgmh4wdezwandwrhogswdezwandwBtAwterminalswinwthewbandwmh4wgw4hlwdez?hwxihqzwsoidhwxihrzwbCCwoecommendationwbkkcjswonwrtBwiocationwqrackingwpystemswqypewlwbiqlcfwlctoberwljkkhwxihszwbCCwoecommendationwbkkckjwonwiocationwqrackingwApplicationwforwbmergencywandwaisasterwpituationsfwlctoberwljkkhwxihkjzwbCCwoeportwkpqwbjaywljkkctw?qhewmracticalwfmplementationwofwoegistrationiCoordinationwjechanismwforwrtBwiqlwbiocationwqrackingwqypewlcwpystems?hwxihkkzwbCCwoeportwkqjwblctoberwljkkctw?bCCwoeportwonwppecificwrtBwApplicationswinwthewBandswmh4wgw4hrwdezwandwpwgwrhowdezwiocationwqrackingwApplicationswforwbmergencywperviceswbiAbpcfwiocationwqrackingwApplicationswqypewlwbiqlcwandwiocationwqrackingwandwpensorwApplicationswforwAutomotivewandwqransportationwbnvironmentswbiqAc?hwxihklzwsoidhwxihkmzwCbmqwoeportw4otw?oeportwfromwCbmqwtowthewburopeanwCommissionwinwresponsewtowthewcifthwjandatewtowCbmqwonwultragwidebandwtechnologywtowclarifywthewtechnicalwparameterswinwviewwofwawpotentialwupdatewofwCommissionwaecisionwljjqikmkibCuwoeportwapprovedwonwlkwgunewljkmwbywthewbCC?hwxihk4zwCommissionwaecisionwljk4iqjlibrwofwqwlctoberwljk4wamendingwaecisionwljjqikmkibCwonwallowingwthewusewofwthewradiowspectrumwforwequipmentwusingwultragwidebandwtechnologywinwawharmonisedwmannerwinwthewCommunitywbnotifiedwunderwdocumentwCbljk4cwqjrmchwxihkozwairectivewljk4iomibrwofwthewburopeanwmarliamentwandwofwthewCouncilwofwkpwAprilwljk4wonwthewharmonisationwofwthewlawswofwthewjemberwptateswrelatingwtowthewmakingwavailablewonwthewmarketwofwradiowequipmentwandwrepealingwairectivewksssioibChwxihkpzwairectivewksssioibCwofwthewburopeanwmarliamentwandwofwthewCouncilwofwswjarchwkssswonwradiowequipmentwandwtelecommunicationswterminalwequipmentwandwthewmutualwrecognitionwofwtheirwconformitywboCqqbwairectivechwxihkqzwbqpfwbkwmjlwjpogkwbshlhkhjctw?phortwoangewaeviceswbpoacwusingwrltrawtidewBandwtechnologywbrtBcuwearmonisedwptandardwcoveringwthewessentialwrequirementswofwarticlewmhlwofwthewairectivewljk4iomibruwmartwktwoequirementswforwdenericwrtBwapplications?hwxihkrzwCommissionwfmplementingwaecisionwCbljkocwomqpwfinalwofw4hrhljkowonwawstandardisationwrequestwtowthewburopeanwCommitteewforwblectrotechnicalwptandardisationwandwtowthewburopeanwqelecommunicationswptandardswfnstitutewaswregardswradiowequipmentwinwsupportwofwairectivewljk4iomibrwofwthewburopeanwmarliamentwandwofwthewCouncilhwSIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 11 3 Definitions, symbols and abbreviations 3.1 Definitions corwthewpurposeswofwthewpresentwdocumentfwthewdefinitionswgivenwinwbqpfwbkwmjmwrrmwxlzwandwthewfollowingwapplytwwtransmitter off time:wtimewintervalwbetweenwtwowconsecutivewburstswwhenwthewrtBwemissionwiswkeptwidlewtransmitter on time:wdurationwofwawburstwirrespectivewofwthewnumberwofwpulseswcontainedw3.2 Symbols corwthewpurposeswofwthewpresentwdocumentfwthewsymbolswgivenwinwbqpfwbkwmjmwrrmwxlzwandwthewfollowingwapplytwdwdistancewkwcoveragewfactorwϕwazimuthwanglewqoffwtransmitterwoffwtimewqonwtransmitterwonwtimew3.3 Abbreviations corwthewpurposeswofwthewpresentwdocumentfwthewabbreviationswgivenwinwbqpfwbkwmjmwrrmwxlzwandwthewfollowingwapplytwwCbmqwburopeanwConferencewofwmostalwandwqelecommunicationswAdministrationswkcwkoisewcigurew4 Technical requirements specifications 4.1 Environmental conditions qhewtechnicalwrequirementswofwthewpresentwdocumentwapplywunderwthewenvironmentalwprofilewforwoperationwofwthewequipmentfwwhichwshallwbewdeclaredwbywthewmanufacturerhwqhewequipmentwshallwcomplywwithwallwthewtechnicalwrequirementswofwthewpresentwdocumentwatwallwtimeswwhenwoperatingwwithinwthewboundarywlimitswofwthewdeclaredwoperationalwenvironmentalwprofilehwqhewnormalwtestwconditionswarewdefinedwinwclausewoh4hmwofwbqpfwbkwmjmwrrmwxlzhw4.2 General rtBwdeviceswinwthewscopewofwthewpresentwdocumentwcanwoperatewinwawbroadwpermittedwrangewofwfrequencieswfromwmjwjezwtowkjfpwdezfwaswdefinedwinwtablewkwofwthewpresentwdocumenthwqhewintendedwrangewofwoperationwgiveswthewpreferredwrangewofwoperatingwfrequencieswforwthewrtBwoperationwbasedwonwthewallowedwspectrumwmaskwwithwincreasewpermittedwemissionwlevelswinwthewintendedwrangewofwoperationhwfnworderwtowclearlywidentifywthewrequiredwlimitswandwthuswmeasurementwprocedureswitwiswessentialwtowdefinewthewoperatingwbandwidthwofwthewrtBwequipmentwunderwtestfwqhewoperatingwbandwidthwofwthewrtBwequipmentwunderwtestwshallwbewthewgkjwdBcwbandwidthwofwthewintendedwrtBwsignalwunderwnormalwoperationalwconditionswaswdefinedwinwbqpfwbkwmjmwrrmwxlzfwclausewoh4hmhwAwsinglewrtBwdevicewcanwhavewmorewthanwonewoperatingwbandwidthhwwqhewbasicwconceptwiswdepictedwinwfigurewkhweerewtwowseparatewoperatingwbandwidthswarewdepictedfwonewwithwawrtBwoperatingwbandwidthwinwthewlowerwfrequencywrangewandwonewinwthewupperwfrequencywrangehwAllwrtBwrelatedwemissionswshallwbewmeasuredwinwthewidentifiedwoperatingwbandwidthwofwthewrtBwdevicewunderwtesthwqhewrequiredwmitigationwtechniqueswarewonlywvalidwinwthewoperatingwbandwidthhwSIST EN 302 065-2 V2.1.1:2017
ETSI ETSI EN 302 065-2 V2.1.1 (2016-11) 12 qhewouwinterferencewsignalwhandlingwiswfocusedwinwthewoperatingwbandwidthwandwsomewclearlywidentifiedwfrequencieswoutsidewthewoperatingwbandwidthbschwqhewoperatingwbandwidthbscwisiarewpartswofwthewpermittedwrangewofwoperationfwseewtablewkhwqhewtestwofwrequiredwmitigationwtechniqueswarewonlywrelevantwinsidewthewoperatingwbandwidthbschwouwinterferencewsignalwhandlingwonwthewoperatingwbandwidthwandwatwdefinedwfrequencieswbelowwandwabovewthewoperatingwrangewlimitshwqbtwqotalwemissionwincludingwrtBwemissionwbmeanwpowerwspectralwdensitycwandwltherwbmissionswblbcwbehghwouwspuriousfwquwspuriouswandwunwantedwem
...











