SIST EN 60644:2010
(Main)Specification for high-voltage fuse-links for motor circuit application (IEC 60644:2009)
Specification for high-voltage fuse-links for motor circuit application (IEC 60644:2009)
This standard applies primarily to fuse-links used with motors started direct-on-line on alternating current systems of 50 Hz and 60 Hz. Fuse-links according to this specification are intended to withstand normal service conditions and motor starting pulses. They should comply with the requirements of IEC 60282-1. The purpose of this standard is to standardize time-current characteristics, to formulate pulse withstand requirements regarding testing and to give guidance regarding the selection of fuselinks intended to be used with motors.
Anforderungen für Hochspannungs-Sicherungseinsätze für Motorstromkreise (IEC 60644:2009)
Spécification relative aux éléments de remplacement à haute tension destinés à des circuits comprenant des moteurs (CEI 60644:2009)
La CEI 60644:2009 s'applique principalement aux éléments de remplacement utilisés avec des moteurs à démarrage direct sur des réseaux en courant alternatif à 50 Hz et 60 Hz. Le but de la présente norme est de normaliser les caractéristiques temps-courant, d'établir des spécifications d'essais concernant la tenue aux impulsions et de donner des conseils pour le choix des éléments de remplacement destinés à être utilisés avec des moteurs. Note: Les éléments de remplacement répondant à cette spécification soient conformes aux exigences de la CEI 60282-1. Les changements majeurs par rapport à l'édition précédente sont les suivants: - mise à jour des références normatives; - reprise des figures.
Specifikacija visokonapetostnih taljivih vložkov za zaščito električnih motorjev (IEC 60644:2009)
Ta standard velja predvsem za taljive vložke varovalk, ki se uporabljajo z motorji, zagnanimi neposredno s povezavo na sisteme z izmenično napetostjo 50 Hz in 60 Hz. Taljivi vložki varovalk so glede na te tehnične zahteve namenjeni, da vzdržijo običajne obratovalne okoliščine in začetne impulze motorja. Biti morajo v skladu z zahtevami IEC 60282-1. Namen tega standarda je standardizirati značilnosti toka v času, oblikovati zahteve za zdržanje impulzov glede preskušanj in podati vodilo glede izbire taljivih vložkov varovalk namenjenih za uporabo pri motorjih.
General Information
Relations
Standards Content (Sample)
SLOVENSKI STANDARD
SIST EN 60644:2010
01-marec-2010
Nadomešča:
SIST EN 60644:1995
Specifikacija visokonapetostnih taljivih vložkov za zaščito električnih motorjev
(IEC 60644:2009)
Specification for high-voltage fuse-links for motor circuit application (IEC 60644:2009)
Anforderungen für Hochspannungs-Sicherungseinsätze für Motorstromkreise (IEC
60644:2009)
Spécification relative aux éléments de remplacement à haute tension destinés à des
circuits comprenant des moteurs (CEI 60644:2009)
Ta slovenski standard je istoveten z: EN 60644:2009
ICS:
29.120.50 Varovalke in druga Fuses and other overcurrent
nadtokovna zaščita protection devices
SIST EN 60644:2010 en,fr
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
SIST EN 60644:2010
---------------------- Page: 2 ----------------------
SIST EN 60644:2010
EUROPEAN STANDARD
EN 60644
NORME EUROPÉENNE
December 2009
EUROPÄISCHE NORM
ICS 29.120.50 Supersedes EN 60644:1993
English version
Specification for high-voltage fuse-links for motor circuit application
(IEC 60644:2009)
Spécification relative aux éléments Anforderungen für Hochspannungs-
de remplacement à haute tension destinés Sicherungseinsätze für Motorstromkreise
à des circuits comprenant des moteurs (IEC 60644:2009)
(CEI 60644:2009)
This European Standard was approved by CENELEC on 2009-10-01. CENELEC members are bound to comply
with the CEN/CENELEC Internal Regulations which stipulate the conditions for giving this European Standard
the status of a national standard without any alteration.
Up-to-date lists and bibliographical references concerning such national standards may be obtained on
application to the Central Secretariat or to any CENELEC member.
This European Standard exists in three official versions (English, French, German). A version in any other
language made by translation under the responsibility of a CENELEC member into its own language and notified
to the Central Secretariat has the same status as the official versions.
CENELEC members are the national electrotechnical committees of Austria, Belgium, Bulgaria, Cyprus, the
Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia,
Lithuania, Luxembourg, Malta, the Netherlands, Norway, Poland, Portugal, Romania, Slovakia, Slovenia, Spain,
Sweden, Switzerland and the United Kingdom.
CENELEC
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung
Central Secretariat: Avenue Marnix 17, B - 1000 Brussels
© 2009 CENELEC - All rights of exploitation in any form and by any means reserved worldwide for CENELEC members.
Ref. No. EN 60644:2009 E
---------------------- Page: 3 ----------------------
SIST EN 60644:2010
EN 60644:2009 - 2 -
Foreword
The text of document 32A/267/CDV, future edition 2 of IEC 60644, prepared by SC 32A, High-voltage
fuses, of IEC TC 32, Fuses, was submitted to the IEC-CENELEC parallel vote and was approved by
CENELEC as EN 60644 on 2009-10-01.
This European Standard supersedes EN 60644:1993.
The main changes with regard to EN 60644:1993 concern the following:
– update of the normative references;
– renewal of the figures.
The following dates were fixed:
– latest date by which the EN has to be implemented
at national level by publication of an identical
national standard or by endorsement (dop) 2010-07-01
– latest date by which the national standards conflicting
with the EN have to be withdrawn (dow) 2012-10-01
Annex ZA has been added by CENELEC.
__________
Endorsement notice
The text of the International Standard IEC 60644:2009 was approved by CENELEC as a European
Standard without any modification.
In the official version, for Bibliography, the following note has to be added for the standard indicated:
IEC 60470 NOTE Harmonized as EN 60470:2000 (not modified).
__________
---------------------- Page: 4 ----------------------
SIST EN 60644:2010
- 3 - EN 60644:2009
Annex ZA
(normative)
Normative references to international publications
with their corresponding European publications
The following referenced documents are indispensable for the application of this document. For dated
references, only the edition cited applies. For undated references, the latest edition of the referenced
document (including any amendments) applies.
NOTE When an international publication has been modified by common modifications, indicated by (mod), the relevant EN/HD
applies.
Publication Year Title EN/HD Year
IEC 60282-1 2005 High-voltage fuses - EN 60282-1 2006
Part 1: Current-limiting fuses
---------------------- Page: 5 ----------------------
SIST EN 60644:2010
---------------------- Page: 6 ----------------------
SIST EN 60644:2010
IEC 60644
®
Edition 2.0 2009-08
INTERNATIONAL
STANDARD
NORME
INTERNATIONALE
Specification for high-voltage fuse-links for motor circuit applications
Spécification relative aux éléments de remplacement à haute tension destinés à
des circuits comprenant des moteurs
INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
COMMISSION
ELECTROTECHNIQUE
PRICE CODE
INTERNATIONALE
M
CODE PRIX
ICS 29.120.50 ISBN 2-8318-1057-5
® Registered trademark of the International Electrotechnical Commission
Marque déposée de la Commission Electrotechnique Internationale
---------------------- Page: 7 ----------------------
SIST EN 60644:2010
– 2 – 60644 © IEC:2009
CONTENTS
FOREWORD.3
1 Scope.5
2 Normative references .5
3 Fuse-link time-current characteristics .5
4 K factor .6
5 Withstand requirements.6
6 Withstand tests.6
6.1 General .6
6.2 Test sequence No. 1 .7
6.3 Test sequence No. 2 .7
6.4 Interpretation of the test results.8
7 Information to be given to the user .8
8 Selection of fuse-links for motor circuit applications and correlation of fuse-link
characteristics with those of other components of the circuit.9
8.1 Selection of fuse-links .9
8.2 Co-ordination with other circuit components .9
Bibliography.12
Figure 1 – Diagrams of the test sequences .7
Figure 2 – Determination of K factor for fuse-links of intermediate rating of a
homogeneous series.8
Figure 3 – Characteristics relating to the protection of a motor circuit .11
---------------------- Page: 8 ----------------------
SIST EN 60644:2010
60644 © IEC:2009 – 3 –
INTERNATIONAL ELECTROTECHNICAL COMMISSION
____________
SPECIFICATION FOR HIGH-VOLTAGE FUSE-LINKS
FOR MOTOR CIRCUIT APPLICATIONS
FOREWORD
1) The International Electrotechnical Commission (IEC) is a worldwide organization for standardization comprising
all national electrotechnical committees (IEC National Committees). The object of IEC is to promote
international co-operation on all questions concerning standardization in the electrical and electronic fields. To
this end and in addition to other activities, IEC publishes International Standards, Technical Specifications,
Technical Reports, Publicly Available Specifications (PAS) and Guides (hereafter referred to as “IEC
Publication(s)”). Their preparation is entrusted to technical committees; any IEC National Committee interested
in the subject dealt with may participate in this preparatory work. International, governmental and non-
governmental organizations liaising with the IEC also participate in this preparation. IEC collaborates closely
with the International Organization for Standardization (ISO) in accordance with conditions determined by
agreement between the two organizations.
2) The formal decisions or agreements of IEC on technical matters express, as nearly as possible, an international
consensus of opinion on the relevant subjects since each technical committee has representation from all
interested IEC National Committees.
3) IEC Publications have the form of recommendations for international use and are accepted by IEC National
Committees in that sense. While all reasonable efforts are made to ensure that the technical content of IEC
Publications is accurate, IEC cannot be held responsible for the way in which they are used or for any
misinterpretation by any end user.
4) In order to promote international uniformity, IEC National Committees undertake to apply IEC Publications
transparently to the maximum extent possible in their national and regional publications. Any divergence
between any IEC Publication and the corresponding national or regional publication shall be clearly indicated in
the latter.
5) IEC provides no marking procedure to indicate its approval and cannot be rendered responsible for any
equipment declared to be in conformity with an IEC Publication.
6) All users should ensure that they have the latest edition of this publication.
7) No liability shall attach to IEC or its directors, employees, servants or agents including individual experts and
members of its technical committees and IEC National Committees for any personal injury, property damage or
other damage of any nature whatsoever, whether direct or indirect, or for costs (including legal fees) and
expenses arising out of the publication, use of, or reliance upon, this IEC Publication or any other IEC
Publications.
8) Attention is drawn to the Normative references cited in this publication. Use of the referenced publications is
indispensable for the correct application of this publication.
9) Attention is drawn to the possibility that some of the elements of this IEC Publication may be the subject of
patent rights. IEC shall not be held responsible for identifying any or all such patent rights.
International Standard IEC 60644 has been prepared by subcommittee 32A: High voltage
fuses, of IEC technical committee 32: Fuses
This second edition cancels and replaces the first edition, published in 1979, and constitutes
a technical revision.
The main changes with regard to the previous edition concern the following:
• update of the normative references;
• renewal of the figures.
---------------------- Page: 9 ----------------------
SIST EN 60644:2010
– 4 – 60644 © IEC:2009
The text of this standard is based on the following documents:
CDV Report on voting
32A/267/CDV 32A/270/RVC
Full information on the voting for the approval of this standard can be found in the report on
voting indicated in the above table.
This publication has been drafted in accordance with the ISO/IEC Directives, Part 2.
The committee has decided that the contents of this publication will remain unchanged until
the maintenance result date indicated on the IEC web site under "http://webstore.iec.ch" in
the data related to the specific publication. At this date, the publication will be
• reconfirmed,
• withdrawn,
• replaced by a revised edition, or
• amended.
---------------------- Page: 10 ----------------------
SIST EN 60644:2010
60644 © IEC:2009 – 5 –
SPECIFICATION FOR HIGH-VOLTAGE FUSE-LINKS
FOR MOTOR CIRCUIT APPLICATIONS
1 Scope
This standard applies primarily to fuse-links used with motors started direct-on-line on
alternating current systems of 50 Hz and 60 Hz.
NOTE When motors are used with assisted starting this specification can also be applied but particular attention
should be paid to the selection of the rated current of the fuse-link (see 8.1) and the manufacturer of the fuse-link
should preferably be consulted.
Fuse-links according to this specification are intended to withstand normal service conditions
and motor starting pulses. They should comply with the requirements of IEC 60282-1.
The purpose of this standard is to standardize time-current characteristics, to formulate pulse
withstand requirements regarding testing and to give guidance regarding the selection of fuse-
links inten
...
SLOVENSKI STANDARD
SIST EN 60644:2010
01-marec-2010
6SHFLILNDFLMDYLVRNRQDSHWRVWQLKWDOMLYLKYORåNRYYDURYDON]DHOHNWULþQDYH]MD
PRWRUMHY ,(&
Specification for high-voltage fuse-links for motor circuit application (IEC 60644:2009)
Anforderungen für Hochspannungs-Sicherungseinsätze für Motorstromkreise (IEC
60644:2009)
Spécification relative aux éléments de remplacement à haute tension destinés à des
circuits comprenant des moteurs (CEI 60644:2009)
Ta slovenski standard je istoveten z: EN 60644:2009
ICS:
29.120.50 9DURYDONHLQGUXJD Fuses and other overcurrent
PHGWRNRYQD]DãþLWD protection devices
SIST EN 60644:2010 en,fr
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
SIST EN 60644:2010
---------------------- Page: 2 ----------------------
SIST EN 60644:2010
EUROPEAN STANDARD
EN 60644
NORME EUROPÉENNE
December 2009
EUROPÄISCHE NORM
ICS 29.120.50 Supersedes EN 60644:1993
English version
Specification for high-voltage fuse-links for motor circuit application
(IEC 60644:2009)
Spécification relative aux éléments Anforderungen für Hochspannungs-
de remplacement à haute tension destinés Sicherungseinsätze für Motorstromkreise
à des circuits comprenant des moteurs (IEC 60644:2009)
(CEI 60644:2009)
This European Standard was approved by CENELEC on 2009-10-01. CENELEC members are bound to comply
with the CEN/CENELEC Internal Regulations which stipulate the conditions for giving this European Standard
the status of a national standard without any alteration.
Up-to-date lists and bibliographical references concerning such national standards may be obtained on
application to the Central Secretariat or to any CENELEC member.
This European Standard exists in three official versions (English, French, German). A version in any other
language made by translation under the responsibility of a CENELEC member into its own language and notified
to the Central Secretariat has the same status as the official versions.
CENELEC members are the national electrotechnical committees of Austria, Belgium, Bulgaria, Cyprus, the
Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia,
Lithuania, Luxembourg, Malta, the Netherlands, Norway, Poland, Portugal, Romania, Slovakia, Slovenia, Spain,
Sweden, Switzerland and the United Kingdom.
CENELEC
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung
Central Secretariat: Avenue Marnix 17, B - 1000 Brussels
© 2009 CENELEC - All rights of exploitation in any form and by any means reserved worldwide for CENELEC members.
Ref. No. EN 60644:2009 E
---------------------- Page: 3 ----------------------
SIST EN 60644:2010
EN 60644:2009 - 2 -
Foreword
The text of document 32A/267/CDV, future edition 2 of IEC 60644, prepared by SC 32A, High-voltage
fuses, of IEC TC 32, Fuses, was submitted to the IEC-CENELEC parallel vote and was approved by
CENELEC as EN 60644 on 2009-10-01.
This European Standard supersedes EN 60644:1993.
The main changes with regard to EN 60644:1993 concern the following:
– update of the normative references;
– renewal of the figures.
The following dates were fixed:
– latest date by which the EN has to be implemented
at national level by publication of an identical
national standard or by endorsement (dop) 2010-07-01
– latest date by which the national standards conflicting
with the EN have to be withdrawn (dow) 2012-10-01
Annex ZA has been added by CENELEC.
__________
Endorsement notice
The text of the International Standard IEC 60644:2009 was approved by CENELEC as a European
Standard without any modification.
In the official version, for Bibliography, the following note has to be added for the standard indicated:
IEC 60470 NOTE Harmonized as EN 60470:2000 (not modified).
__________
---------------------- Page: 4 ----------------------
SIST EN 60644:2010
- 3 - EN 60644:2009
Annex ZA
(normative)
Normative references to international publications
with their corresponding European publications
The following referenced documents are indispensable for the application of this document. For dated
references, only the edition cited applies. For undated references, the latest edition of the referenced
document (including any amendments) applies.
NOTE When an international publication has been modified by common modifications, indicated by (mod), the relevant EN/HD
applies.
Publication Year Title EN/HD Year
IEC 60282-1 2005 High-voltage fuses - EN 60282-1 2006
Part 1: Current-limiting fuses
---------------------- Page: 5 ----------------------
SIST EN 60644:2010
---------------------- Page: 6 ----------------------
SIST EN 60644:2010
IEC 60644
®
Edition 2.0 2009-08
INTERNATIONAL
STANDARD
NORME
INTERNATIONALE
Specification for high-voltage fuse-links for motor circuit applications
Spécification relative aux éléments de remplacement à haute tension destinés à
des circuits comprenant des moteurs
INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
COMMISSION
ELECTROTECHNIQUE
PRICE CODE
INTERNATIONALE
M
CODE PRIX
ICS 29.120.50 ISBN 2-8318-1057-5
® Registered trademark of the International Electrotechnical Commission
Marque déposée de la Commission Electrotechnique Internationale
---------------------- Page: 7 ----------------------
SIST EN 60644:2010
– 2 – 60644 © IEC:2009
CONTENTS
FOREWORD.3
1 Scope.5
2 Normative references .5
3 Fuse-link time-current characteristics .5
4 K factor .6
5 Withstand requirements.6
6 Withstand tests.6
6.1 General .6
6.2 Test sequence No. 1 .7
6.3 Test sequence No. 2 .7
6.4 Interpretation of the test results.8
7 Information to be given to the user .8
8 Selection of fuse-links for motor circuit applications and correlation of fuse-link
characteristics with those of other components of the circuit.9
8.1 Selection of fuse-links .9
8.2 Co-ordination with other circuit components .9
Bibliography.12
Figure 1 – Diagrams of the test sequences .7
Figure 2 – Determination of K factor for fuse-links of intermediate rating of a
homogeneous series.8
Figure 3 – Characteristics relating to the protection of a motor circuit .11
---------------------- Page: 8 ----------------------
SIST EN 60644:2010
60644 © IEC:2009 – 3 –
INTERNATIONAL ELECTROTECHNICAL COMMISSION
____________
SPECIFICATION FOR HIGH-VOLTAGE FUSE-LINKS
FOR MOTOR CIRCUIT APPLICATIONS
FOREWORD
1) The International Electrotechnical Commission (IEC) is a worldwide organization for standardization comprising
all national electrotechnical committees (IEC National Committees). The object of IEC is to promote
international co-operation on all questions concerning standardization in the electrical and electronic fields. To
this end and in addition to other activities, IEC publishes International Standards, Technical Specifications,
Technical Reports, Publicly Available Specifications (PAS) and Guides (hereafter referred to as “IEC
Publication(s)”). Their preparation is entrusted to technical committees; any IEC National Committee interested
in the subject dealt with may participate in this preparatory work. International, governmental and non-
governmental organizations liaising with the IEC also participate in this preparation. IEC collaborates closely
with the International Organization for Standardization (ISO) in accordance with conditions determined by
agreement between the two organizations.
2) The formal decisions or agreements of IEC on technical matters express, as nearly as possible, an international
consensus of opinion on the relevant subjects since each technical committee has representation from all
interested IEC National Committees.
3) IEC Publications have the form of recommendations for international use and are accepted by IEC National
Committees in that sense. While all reasonable efforts are made to ensure that the technical content of IEC
Publications is accurate, IEC cannot be held responsible for the way in which they are used or for any
misinterpretation by any end user.
4) In order to promote international uniformity, IEC National Committees undertake to apply IEC Publications
transparently to the maximum extent possible in their national and regional publications. Any divergence
between any IEC Publication and the corresponding national or regional publication shall be clearly indicated in
the latter.
5) IEC provides no marking procedure to indicate its approval and cannot be rendered responsible for any
equipment declared to be in conformity with an IEC Publication.
6) All users should ensure that they have the latest edition of this publication.
7) No liability shall attach to IEC or its directors, employees, servants or agents including individual experts and
members of its technical committees and IEC National Committees for any personal injury, property damage or
other damage of any nature whatsoever, whether direct or indirect, or for costs (including legal fees) and
expenses arising out of the publication, use of, or reliance upon, this IEC Publication or any other IEC
Publications.
8) Attention is drawn to the Normative references cited in this publication. Use of the referenced publications is
indispensable for the correct application of this publication.
9) Attention is drawn to the possibility that some of the elements of this IEC Publication may be the subject of
patent rights. IEC shall not be held responsible for identifying any or all such patent rights.
International Standard IEC 60644 has been prepared by subcommittee 32A: High voltage
fuses, of IEC technical committee 32: Fuses
This second edition cancels and replaces the first edition, published in 1979, and constitutes
a technical revision.
The main changes with regard to the previous edition concern the following:
• update of the normative references;
• renewal of the figures.
---------------------- Page: 9 ----------------------
SIST EN 60644:2010
– 4 – 60644 © IEC:2009
The text of this standard is based on the following documents:
CDV Report on voting
32A/267/CDV 32A/270/RVC
Full information on the voting for the approval of this standard can be found in the report on
voting indicated in the above table.
This publication has been drafted in accordance with the ISO/IEC Directives, Part 2.
The committee has decided that the contents of this publication will remain unchanged until
the maintenance result date indicated on the IEC web site under "http://webstore.iec.ch" in
the data related to the specific publication. At this date, the publication will be
• reconfirmed,
• withdrawn,
• replaced by a revised edition, or
• amended.
---------------------- Page: 10 ----------------------
SIST EN 60644:2010
60644 © IEC:2009 – 5 –
SPECIFICATION FOR HIGH-VOLTAGE FUSE-LINKS
FOR MOTOR CIRCUIT APPLICATIONS
1 Scope
This standard applies primarily to fuse-links used with motors started direct-on-line on
alternating current systems of 50 Hz and 60 Hz.
NOTE When motors are used with assisted starting this specification can also be applied but particular attention
should be paid to the selection of the rated current of the fuse-link (see 8.1) and the manufacturer of the fuse-link
should preferably be consulted.
Fuse-links according to this specification are intended to withstand normal service conditions
and motor starting pulses. They should comply with the requirements of IEC 60282-1.
The purpose of this standard is to standardize time-current characteristics, to formulate pulse
withstand requirements regarding testing and to give guidance regarding the selection of fuse-
links intended to be u
...
Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.