SIST ISO 7087:2001
(Main)Ferroalloys -- Experimental methods for the evaluation of the quality variation and methods for checking the precision of sampling
Ferroalloys -- Experimental methods for the evaluation of the quality variation and methods for checking the precision of sampling
Specifies methods for the purposes of determining the parameters of random sampling given in the relevant International Standards. Includes an annex.
Ferro-alliages -- Méthodes expérimentales d'évaluation de la variation de qualité et méthodes de contrôle de la fidélité de l'échantillonnage
Ferozlitne - Preiskovalne metode za vrednotenje nihanja kakovosti in metode za preverjanje natančnosti vzorčenja
General Information
Buy Standard
Standards Content (Sample)
International Standard 7087
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.ME~YHAPO~HAR OPTAHMSAl#lR fl0 CTAH~APTM3AlWl@ORGANlSATlON INTERNATIONALE DE NORMALISATION
Ferroalloys - Experimental methods for the evaluation of
the quality variation and methods for checking the
precision of sampling
Ferro-alliages - M&odes exphmen tales d’haluation de la variation de qualith et rnh thodes de con tr6le de la fidklitb de
l%chan tillonnage
First edition - 1984-11-01
UDC 669.15498 : 620.11 Ref. No. IS0 70874984 (E)
Descriptors : ferroalloys, estimation, quality, variation, experimental data, sampling.
Price based on 13 pages
---------------------- Page: 1 ----------------------
Foreword
IS0 (the International Organization for Standardization) is a worldwide federation of
national standards bodies (IS0 member bodies). The work of preparing International
Standards is normally carried out through IS0 technical committees. Each member
body interested in a subject for which a technical committee has been established has
the right to be represented on that committee. International organizations, govern-
mental and non-governmental, in liaison with ISO, also take part in the work.
Draft International Standards adopted by the technical committees are circulated to
the member bodies for approval before their acceptance as International Standards by
the IS0 Council. They are approved in accordance with IS0 procedures requiring at
least 75 % approval by the member bodies voting.
International Standard IS0 7087 was prepared by Technical Committee ISO/TC 132,
Ferroallo ys.
0 International Organization for Standardization, 1984
Printed in Switzerland
---------------------- Page: 2 ----------------------
Contents
Page
1
1 Scope and field of application . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . , .
1
2 References . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
1
....................................
3 General requirements for experiment
1
3.1 Quality variation .
2
3.2 Quality characteristic. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Evaluation of the quality variation of ferroalloys . . . . . . . . . . . . . . . . . . . . . . 2
3.3
2
3.4 Consignments for experiment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
3.5 Method for sampling and chemical analysis . . . . . . . . . . . . . . . . . . . . . . . . . . 2
2
3.6 Number of experiments. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
3.7 Order of chemical determinations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
4 Experimental methods . . . . . . . . . , . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
4.1 Types of experiment .
2
4.2 Type1 .
3
.........................................................
4.3 Typell
............................... 9
5 Methods for analysis of experimental data.
9
5.1 Selection of the method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.2 Method for data analysis for random sampling . . . . . . . . . . . . . . . . . . . . . . .
9
5.3 Method for data analysis for two-stage sampling . . . . . . . . . . . . . . . . . . . . .
10
6 Expression of experimental results . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10
6.1 Random sampling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10
6.2 Two-stage sampling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Estimation for precision of sampling. 10
7 .
7.1 Method for random sampling . 10
10
7.2 Method for two-stage sampling. .
11
7.3 Actions after review of estimated results . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Annex
Example of two other methods for the calculation of quality variation value
12
(for two-stage sampling) for an experiment of 10 consignments . . . . . . . . . . . . . . . .
. . .
III
---------------------- Page: 3 ----------------------
This page intentionally left blank
---------------------- Page: 4 ----------------------
IS0 70874984 (E)
INTERNATIONAL STANDARD
Ferroalloys - Experimental methods for the evaluation of
the quality variation and methods for checking the
precision of sampling
I S 0 5449, Ferrosilicochromium - Specification and conditions
1 Scope and field of application
of delivery.
This International Standard specifies experimental methods for
IS0 5450, Ferrotungsten - Specification and conditions of
the evaluation of quality variation of ferroalloys for the pur-
delivery.
poses of determining the parameters of random sampling and
two-stage sampling given in the relevant International Stan-
IS0 5451, Ferrovanadium - Specification and conditions of
dards. It also specifies the methods for checking the precision
delivery.
of taking samples by the random method and two-stage
method.
IS0 5452, Ferromolybdenum - Specification and conditions
of delivery.
2 References
IS0 5453, Ferroniobium - Specification and conditions of
IS0 3713, Ferroalloys - Sampling and sample preparation - delivery.
general rules. 1)
IS0 5454, Ferrotitanium - Specification and conditions of
IS0 4552/l, Ferroalloys - Sampling and sample preparation delivery.
for chemical analysis - Part 7 : Ferrochromium, ferro-
silicochromium, ferrosilicon, ferrosilicomanganese and ferro- IS0 7347, Ferroalloys - Experimental methods for checking
manganese. 1) the bias of sampling and sample preparation. 1 J
IS0 455212, Ferroalloys - Sampling and sample preparation IS0 7373, Ferroalloys - Experimental methods for checking
Part 2 : Ferrotitanium, ferromolyb-
for chemical analysis - the precision of sample division. 1)
denum, ferro tungsten, ferroniobium and ferrovanadium. 1)
Specification and conditions of
IS0 5445, Ferrosilicon -
3 General requirements for experiment
delivery.
Specification and conditions of 3.1 Quality variation
IS0 5446, Ferromanganese -
delivery.
The quality variation is a measure of heterogeneity of the fer-
roalloy and is expressed in terms of the standard deviation
IS0 5447, FerrosKcomanganese - Specification and con-
ditions of delivery. denoted by 0. It shall be the standard deviation between in-
crements (ai) for random sampling, and the standard devia-
I S 0 5443, Ferrochromium - Specification and conditions of tions between packed units (or,) and within packed units (cQ,,,)
delivery. for two-stage sampling.
1) At present at the stage of draft.
---------------------- Page: 5 ----------------------
Is0 70874984 (El
The experiment shall be repeated at least IO times.
NOTES
1 Random sampling is applied to consignments of ferroalloys,
whether crushable or uncrushable, delivered in bulk.
37 . Order of chemical determinations
2 Two-stage sampling is applied to consignments delivered in packed
sequence of chemical determinations of a set of
units. The
exper timental test samples shall be in random order.
3.2 Quality characteristic
4
Experimental methods
The quality characteristic for the determination of the quality
variation is given in the relevant International Standards on
methods for ferroalloy sampling.
4.1 Types of experiment
The content of any other element may be selected as the
4.1.1
quality characteristic by mutual agreement between the parties Type I for ferroalloys sampled by the random
concerned. meth od
This type of experiment is applied to ferroalloys in bulk.
3.3 Evaluation of the quality variation of
ferroalloys
4.1.2 Type II for ferroalloys sampled by the two-stage
evaluated for each type of ferro-
The quality variation shall be method
alloy as designated between the parties concerned.
This type of experiment is applied to ferroalloys in packed units.
34 . Consignments for experiment
4.2 Type I
The value of quality variation of a consignment of a ferroalloy is
related to the method of constituting the consignment. Three
4.2.1 Method for crushable ferroalloys (see figure 1)
methods are practised depending upon the process of produc-
tion and the type of ferroalloy. These are tapped lot method,
This method is applicable to ferroalloys of which increments of
graded lot method and blended lot method.
a sample are obtained with a sampling device such as an incre-
ment shovel.
For the tapped lot method, the value of the quality variation
tends to be small and depends on the degree of crushing and
The number of in crements to be taken from a ferroalloy con-
on the thoroughness of mixing of the material. If the experi-
signment shall be 10 or mo #re.
ment is conducted on consignments constituted by this
method, it is liable to underestimate the value of the quality
Duplicate test samples shall be prepared from each of the in-
variation.
crements.
For the graded lot method, the difference between the taps
A single chemical determination of the quality characteristic
constituting a consignment shall be as given in the relevant
shall be carried out on each of the test samples in random
International Standards on technical conditions for delivery of
order.
ferroalloys. Quality variation of other differences between the
taps of a consignment may be determined by agreement
The data for the experiment shall be recorded on a data log
between the parties concerned.
such as that given in table 1 as an example.
Quality variation experiments are preferably carried out on con-
signments constituted by the graded lot method, in order to
4.2.2 Method for uncrushable ferroalloys (see figure 2)
obtain the most reliable estimate of quality variation.
This method is applicable to ferroalloys of which increments of
a sample are obtained as chippings from each of the selected
3.5 Method for sampling and chemical analysis
lumps by means of a drilling machine.
Sampling, preparation of samples and chemical analysis for ex-
The number of lumps to be taken from a ferroalloy
consign-
perimental purposes shall be carried out in accordance with the
ment delivered in bulk shall be 10 or more.
relevant International Standards.
Each increment as a mass of chi shall be taken from
each
PPiW
of the selected lumps.
36 . Number of experiments
Duplicate test samples shall be prepared from each increment.
The experiment shall be conducted on one consignment. For
random sampling, an experiment shall cover either the whole
A single chemical determination of the quality characteristic
consignment or part of the consignment. For two-stage sampl-
ing, it shall cover m packed units out of A4 packed units of the shall be carried out on each of the test samples in random
order.
consignment.
2
---------------------- Page: 6 ----------------------
Is0 70874984 (El
Two different binary subsamples denoted by A, B; C, D, com-
The data for the experiment shall be recorded on a data log
posed each of four increments, shall be constituted as follows :
such as that given in table 1 as an example.
A and B each consist of one increment from each of the four
selected packed units; C consists of two increments from each
4.3 Type II
of the even-number packed units; D consists of two increments
from each of the two odd-number packed units.
This method is applied to consignments of ferroalloys, whether
crushable or uncrushable, delivered in packed units (see
The test samples shall be prepared from the subsamples as
figure 3).
follows : two test samples for each of the subsamples A and C;
A total of m packed units shall be selected at the first stage of one test sample for each of the subsamples B and D.
two-stage sampling.
A single chemical determination of the quality characteristic
NOTE - For the sake of convenience in the treatment of the data, it is
shall be carried out on each of the test samples in random
recommended that the number m be an even number.
order.
At the second stage of two-stage sampling, each of four in-
crements in the form of particles or chippings shall be taken The data for an experiment shall be recorded on a data log such
from within each of the selected packed units. as that given in table 2 as an example.
---------------------- Page: 7 ----------------------
Is0 70874984 (El
Consignment
increments
(i = 1, 2, . . . . k)
. r
i t
‘il ,kl k2
Duplicate ‘12 ‘21 22 112
test
samples
(i = 1 and 2)
Measurements X X X
X X
i
Xl
xi2
12 21 22 kl
k2
(chemical
determinations)
Figure 1 - Flow scheme for crushable ferroalloys (Type I)
4
---------------------- Page: 8 ----------------------
IS0 70874984 (El
Table 1 - Data log for the experiment (Type I) (Example for k = 10)
Data sheet No. : Name of company and works :
Particulars of experime
...
SLOVENSKI STANDARD
SIST ISO 7087:2001
01-november-2001
)HUR]OLWQH3UHLVNRYDOQHPHWRGH]DYUHGQRWHQMHQLKDQMDNDNRYRVWLLQPHWRGH]D
SUHYHUMDQMHQDWDQþQRVWLY]RUþHQMD
Ferroalloys -- Experimental methods for the evaluation of the quality variation and
methods for checking the precision of sampling
Ferro-alliages -- Méthodes expérimentales d'évaluation de la variation de qualité et
méthodes de contrôle de la fidélité de l'échantillonnage
Ta slovenski standard je istoveten z: ISO 7087:1984
ICS:
77.100 Železove zlitine Ferroalloys
SIST ISO 7087:2001 en
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
SIST ISO 7087:2001
---------------------- Page: 2 ----------------------
SIST ISO 7087:2001
International Standard 7087
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.ME~YHAPO~HAR OPTAHMSAl#lR fl0 CTAH~APTM3AlWl@ORGANlSATlON INTERNATIONALE DE NORMALISATION
Ferroalloys - Experimental methods for the evaluation of
the quality variation and methods for checking the
precision of sampling
Ferro-alliages - M&odes exphmen tales d’haluation de la variation de qualith et rnh thodes de con tr6le de la fidklitb de
l%chan tillonnage
First edition - 1984-11-01
UDC 669.15498 : 620.11 Ref. No. IS0 70874984 (E)
Descriptors : ferroalloys, estimation, quality, variation, experimental data, sampling.
Price based on 13 pages
---------------------- Page: 3 ----------------------
SIST ISO 7087:2001
Foreword
IS0 (the International Organization for Standardization) is a worldwide federation of
national standards bodies (IS0 member bodies). The work of preparing International
Standards is normally carried out through IS0 technical committees. Each member
body interested in a subject for which a technical committee has been established has
the right to be represented on that committee. International organizations, govern-
mental and non-governmental, in liaison with ISO, also take part in the work.
Draft International Standards adopted by the technical committees are circulated to
the member bodies for approval before their acceptance as International Standards by
the IS0 Council. They are approved in accordance with IS0 procedures requiring at
least 75 % approval by the member bodies voting.
International Standard IS0 7087 was prepared by Technical Committee ISO/TC 132,
Ferroallo ys.
0 International Organization for Standardization, 1984
Printed in Switzerland
---------------------- Page: 4 ----------------------
SIST ISO 7087:2001
Contents
Page
1
1 Scope and field of application . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . , .
1
2 References . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
1
....................................
3 General requirements for experiment
1
3.1 Quality variation .
2
3.2 Quality characteristic. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Evaluation of the quality variation of ferroalloys . . . . . . . . . . . . . . . . . . . . . . 2
3.3
2
3.4 Consignments for experiment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
3.5 Method for sampling and chemical analysis . . . . . . . . . . . . . . . . . . . . . . . . . . 2
2
3.6 Number of experiments. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
3.7 Order of chemical determinations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
4 Experimental methods . . . . . . . . . , . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2
4.1 Types of experiment .
2
4.2 Type1 .
3
.........................................................
4.3 Typell
............................... 9
5 Methods for analysis of experimental data.
9
5.1 Selection of the method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.2 Method for data analysis for random sampling . . . . . . . . . . . . . . . . . . . . . . .
9
5.3 Method for data analysis for two-stage sampling . . . . . . . . . . . . . . . . . . . . .
10
6 Expression of experimental results . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10
6.1 Random sampling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10
6.2 Two-stage sampling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Estimation for precision of sampling. 10
7 .
7.1 Method for random sampling . 10
10
7.2 Method for two-stage sampling. .
11
7.3 Actions after review of estimated results . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Annex
Example of two other methods for the calculation of quality variation value
12
(for two-stage sampling) for an experiment of 10 consignments . . . . . . . . . . . . . . . .
. . .
III
---------------------- Page: 5 ----------------------
SIST ISO 7087:2001
This page intentionally left blank
---------------------- Page: 6 ----------------------
SIST ISO 7087:2001
IS0 70874984 (E)
INTERNATIONAL STANDARD
Ferroalloys - Experimental methods for the evaluation of
the quality variation and methods for checking the
precision of sampling
I S 0 5449, Ferrosilicochromium - Specification and conditions
1 Scope and field of application
of delivery.
This International Standard specifies experimental methods for
IS0 5450, Ferrotungsten - Specification and conditions of
the evaluation of quality variation of ferroalloys for the pur-
delivery.
poses of determining the parameters of random sampling and
two-stage sampling given in the relevant International Stan-
IS0 5451, Ferrovanadium - Specification and conditions of
dards. It also specifies the methods for checking the precision
delivery.
of taking samples by the random method and two-stage
method.
IS0 5452, Ferromolybdenum - Specification and conditions
of delivery.
2 References
IS0 5453, Ferroniobium - Specification and conditions of
IS0 3713, Ferroalloys - Sampling and sample preparation - delivery.
general rules. 1)
IS0 5454, Ferrotitanium - Specification and conditions of
IS0 4552/l, Ferroalloys - Sampling and sample preparation delivery.
for chemical analysis - Part 7 : Ferrochromium, ferro-
silicochromium, ferrosilicon, ferrosilicomanganese and ferro- IS0 7347, Ferroalloys - Experimental methods for checking
manganese. 1) the bias of sampling and sample preparation. 1 J
IS0 455212, Ferroalloys - Sampling and sample preparation IS0 7373, Ferroalloys - Experimental methods for checking
Part 2 : Ferrotitanium, ferromolyb-
for chemical analysis - the precision of sample division. 1)
denum, ferro tungsten, ferroniobium and ferrovanadium. 1)
Specification and conditions of
IS0 5445, Ferrosilicon -
3 General requirements for experiment
delivery.
Specification and conditions of 3.1 Quality variation
IS0 5446, Ferromanganese -
delivery.
The quality variation is a measure of heterogeneity of the fer-
roalloy and is expressed in terms of the standard deviation
IS0 5447, FerrosKcomanganese - Specification and con-
ditions of delivery. denoted by 0. It shall be the standard deviation between in-
crements (ai) for random sampling, and the standard devia-
I S 0 5443, Ferrochromium - Specification and conditions of tions between packed units (or,) and within packed units (cQ,,,)
delivery. for two-stage sampling.
1) At present at the stage of draft.
---------------------- Page: 7 ----------------------
SIST ISO 7087:2001
Is0 70874984 (El
The experiment shall be repeated at least IO times.
NOTES
1 Random sampling is applied to consignments of ferroalloys,
whether crushable or uncrushable, delivered in bulk.
37 . Order of chemical determinations
2 Two-stage sampling is applied to consignments delivered in packed
sequence of chemical determinations of a set of
units. The
exper timental test samples shall be in random order.
3.2 Quality characteristic
4
Experimental methods
The quality characteristic for the determination of the quality
variation is given in the relevant International Standards on
methods for ferroalloy sampling.
4.1 Types of experiment
The content of any other element may be selected as the
4.1.1
quality characteristic by mutual agreement between the parties Type I for ferroalloys sampled by the random
concerned. meth od
This type of experiment is applied to ferroalloys in bulk.
3.3 Evaluation of the quality variation of
ferroalloys
4.1.2 Type II for ferroalloys sampled by the two-stage
evaluated for each type of ferro-
The quality variation shall be method
alloy as designated between the parties concerned.
This type of experiment is applied to ferroalloys in packed units.
34 . Consignments for experiment
4.2 Type I
The value of quality variation of a consignment of a ferroalloy is
related to the method of constituting the consignment. Three
4.2.1 Method for crushable ferroalloys (see figure 1)
methods are practised depending upon the process of produc-
tion and the type of ferroalloy. These are tapped lot method,
This method is applicable to ferroalloys of which increments of
graded lot method and blended lot method.
a sample are obtained with a sampling device such as an incre-
ment shovel.
For the tapped lot method, the value of the quality variation
tends to be small and depends on the degree of crushing and
The number of in crements to be taken from a ferroalloy con-
on the thoroughness of mixing of the material. If the experi-
signment shall be 10 or mo #re.
ment is conducted on consignments constituted by this
method, it is liable to underestimate the value of the quality
Duplicate test samples shall be prepared from each of the in-
variation.
crements.
For the graded lot method, the difference between the taps
A single chemical determination of the quality characteristic
constituting a consignment shall be as given in the relevant
shall be carried out on each of the test samples in random
International Standards on technical conditions for delivery of
order.
ferroalloys. Quality variation of other differences between the
taps of a consignment may be determined by agreement
The data for the experiment shall be recorded on a data log
between the parties concerned.
such as that given in table 1 as an example.
Quality variation experiments are preferably carried out on con-
signments constituted by the graded lot method, in order to
4.2.2 Method for uncrushable ferroalloys (see figure 2)
obtain the most reliable estimate of quality variation.
This method is applicable to ferroalloys of which increments of
a sample are obtained as chippings from each of the selected
3.5 Method for sampling and chemical analysis
lumps by means of a drilling machine.
Sampling, preparation of samples and chemical analysis for ex-
The number of lumps to be taken from a ferroalloy
consign-
perimental purposes shall be carried out in accordance with the
ment delivered in bulk shall be 10 or more.
relevant International Standards.
Each increment as a mass of chi shall be taken from
each
PPiW
of the selected lumps.
36 . Number of experiments
Duplicate test samples shall be prepared from each increment.
The experiment shall be conducted on one consignment. For
random sampling, an experiment shall cover either the whole
A single chemical determination of the quality characteristic
consignment or part of the consignment. For two-stage sampl-
ing, it shall cover m packed units out of A4 packed units of the shall be carried out on each of the test samples in random
order.
consignment.
2
---------------------- Page: 8 ----------------------
SIST ISO 7087:2001
Is0 70874984 (El
Two different binary subsamples denoted by A, B; C, D, com-
The data for the experiment shall be recorded on a data log
posed each of four increments, shall be constituted as follows :
such as that given in table 1 as an example.
A and B each consist of one increment from each of the four
selected packed units; C consists of two increments from each
4.3 Type II
of the even-number packed units; D consists of two increments
from each of the two odd-number packed units.
This method is applied to consignments of ferroalloys, whether
crushable or uncrushable, delivered in packed units (see
The test samples shall be prepared from the subsamples as
figure 3).
follows : two test samples for each of the subsamples A and C;
A total of m packed units shall be selected at the first stage of one test sample for each of the subsamples B and D.
two-stage sampling.
A single chemical determination of the quality characteristic
NOTE - For the sake of convenience in the treatment of the data, it is
shall be carried out on each of the test samples in random
recommended that the number m be an even number.
order.
At the second stage of two-stage sampling, each of four in-
crements in the form of particles or chippings shall be taken The data for an experiment shall be recorded on a data log such
from within each of the selected packed units. as that given in table 2 as an example.
---------------------- Page: 9 ----------------
...
Norme internationale
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.ME~YHAPOAHAR OPTAHM3AlWlR Il0 CTAH~APTH3ALWWORGANISATION INTERNATIONALE DE NORMALISATION
Ferro-alliages - Méthodes expérimentales d’évaluation
de la variation de qualité et méthodes de contrôle de la
fidélité de l’échantillonnage
Ferroallo ys - Experimental methods for the evaluation of the quality variation and methods for checking the precision of sampling
Première édition - 1984-11-01
Réf. no : ISO 70874984 (F)
CDU 669.15498 : 620.11
: ferro-alliage, estimation, qualité, variation, donnée expérimentale, échantillonnage.
Descripteurs
Prix basé sur 13 pages
---------------------- Page: 1 ----------------------
Avant-propos
L’ISO (Organisation internationale de normalisation) est une fédération mondiale
d’organismes nationaux de normalisation (comités membres de I’ISO). L’élaboration
des Normes internationales est confiée aux comités techniques de I’ISO. Chaque
comité membre intéressé par une étude a le droit de faire partie du comité technique
créé à cet effet. Les organisations internationales, gouvernementales et non gouverne-
mentales, en liaison avec I’ISO, participent également aux travaux.
Les projets de Normes internationales adoptés par les comités techniques sont soumis
aux comités membres pour approbation, avant leur acceptation comme Normes inter-
nationales par le Conseil de I’ISO. Les Normes internationales sont approuvées confor-
mément aux procédures de I’ISO qui requiérent l’approbation de 75 % au moins des
comités membres votants.
La Norme internationale ISO 7087 a été élaborée par le comité technique ISO/TC 132,
Ferro-alliages.
Organisation internationale de normalisation, 1984
0
Imprimé en Suisse
---------------------- Page: 2 ----------------------
Sommaire
Page
1
1 Objet et domaine d’application . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2 Références. 1
1
3 Règles générales pour l’exécution d’un essai. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
1
3.1 Variation de qualité . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
............................................. 2
3.2 Caractère de qualité.
................. 2
3.3 Estimation de la variation de qualité des ferro-alliages
............................................. 2
3.4 Livraisons pour essai
................... 2
3.5 Méthodes d’échantillonnage et d’analyse chimique
................................................ 2
3.6 Nombre d’essais.
2
3.7 Ordre de l’exécution des déterminations chimiques . . . . . . . . . . . . . . . . . . .
............................................. 2
4 Méthodes expérimentales
4.1 Types d’essai . 2
2
4.2 Type1 .
3
4.3 Typell .
9
5 Méthodes d’analyse des données expérimentales . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.1 Choix de la méthode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.2 Méthode d’analyse des données pour l’échantillonnage au hasard. . . . . . .
... 9
5.3 Méthode d’analyse des données pour l’échantillonnage à deux degrés
............................................... 10
6 Expression des résultats
........................................ 10
6.1 Échantillonnage au hasard
6.2 Échantillonnage à deux degrés. . 10
................................ 10
7 Évaluation de la fidélité d’échantillonnage
.................... 10
7.1 Méthode utilisée pour l’échantillonnage au hasard
10
7.2 Méthode utilisée pour l’échantillonnage à deux degrés . . . . . . . . . . . . . . . .
7.3 Actions entreprises aprés l’analyse des résultats des essais . . . . . . . . . . . . . 11
Annexe
Exemple de deux autres méthodes de calcul de la variation de qualité
12
(cas d’échantillonnage à deux degrés) pour un essai exécuté sur 10 livraisons. . . . .
. . .
III
---------------------- Page: 3 ----------------------
Page blanche
---------------------- Page: 4 ----------------------
ISO 70874984 (F)
NORME INTERNATIONALE
Méthodes expérimentales d’évaluation
Ferro-alliages -
de la variation de qualité et méthodes de contrôle de la
fidélité de l’échantillonnage
ISO 5449, Ferro-silice-chrome
1 Objet et domaine d’application - Spécifïca tions et conditions
de livraison.
La présente Norme internationale spécifie les méthodes expéri-
mentales d’évaluation de la variation de qualité des ferro- ISO 5450, Ferro-tungstène -
Spécifications et conditions de
alliages afin de déterminer les paramètres de l’échantillonnage livraison.
au hasard et ceux de l’échantillonnage à deux degrés, confor-
mément aux Normes internationales appropriées. Elle spécifie
ISO 5451, Ferro-vanadium
- Spécifications et conditions de
également les méthodes de contrôle de la fidélité de prélève-
livraison.
ment des échantillons par méthode au hasard et par méthode à
deux degrés.
ISO 5452, Ferro-molybdène
- Spécifications et conditions de
livraison.
2 Références
ISO 5453, Ferro-niobium - Spécifications et conditions de
livraison.
Prélèvement et préparation des
ISO 3713, Ferro-alliages -
échantillons - Règles générales. 1)
ISO 5454, Ferro- titane - Spécifications et conditions de
livraison.
Prélèvement et préparation des
ISO 455211, Ferro-alliages -
échantillons pour analyse chimique - Partie 7 : Ferro-chrome,
ISO 7347, Ferro-alliages - Méthodes expérimentales d’évalua-
ferro-silice-chrome, ferro-silicium, ferro-silice-manganèse et
tion de l’erreur systèmatique de prélèvement et de préparation
ferro-manganèse. 1)
des échantillons. 1)
ISO 455212, Ferro-alliages - Prélèvement et préparation des
ISO 7373, Ferro-alliages - Méthodes experimen tales d’évalua-
échantillons pour analayse chimique - Partie 2 : Ferro-titane,
tion de la fidélité de division des échantillons. 1)
ferro-molybdène, ferro- tungstène, ferro-niobium et ferro-
vanadium. 1)
3 Règles générales pour l’exécution d’un
Spécifications et conditions de
ISO 5445, Ferro-silicium -
essai
livraison.
ISO 5446, Ferro-manganèse - Spécifications et conditions de
3.1 Variation de qualité
livraison.
La variation de qualité est la mesure de l’hétérogénéité d’un
I S 0 5447, Ferro-silice-manganèse - Spécifications et condi- ferro-alliage exprimée par l’écart-type et désignée par 0. Pour
tions de livraison. un échantillonnage au hasard, c’est l’écart-type entre les prélè-
vements élémentaires (oi); pour un échantillonnage à deux
ISO 5443, Ferro-chrome - Spécifications et conditions de degrés, ce sont les écarts-types entre les unités d’emballage
livraison.
(~1 et à l’intérieur des unités d’emballage (a,).
1) Actuellement au stade de projet.
---------------------- Page: 5 ----------------------
60 7087-1984 (F)
NOTES 3.6 Nombre d’essais
1 L’échantillonnage au hasard s’applique aux livraisons d’un ferro-
L’essai doit être effectué sur une seule livraison. Pour un
alliage tivré en vrac, qu’il soit concassable ou non concassable.
échantillonnage simple au hasard, l’essai peut être effectué sur
une livraison toute entière ou sur une partie de livraison. Pour
2 L’échantillonnage à deux degrés s’applique aux livraisons fournies
un échantillonnage à deux degrés, l’essai devrait être effectué
sous emballage.
sur m unités d’emballage choisies parmi A4 unités de la livrai-
son.
3.2 Caractère de qualité
Cet essai doit être répété au moins 10 fois.
Le caract&re de qualité pour déterminer la variation de qualité
est donné dans les Normes internationales appropriées relatives 3.7 Ordre de l’exécution des déterminations
aux méthodes d’échantillonnage des ferro-alliages.
chimiques
La succession des déterminations chimiques effectuées sur une
La teneur de n’importe quel autre élément peut être prise pour
série d’échantillons expérimentaux pour essai est arbitraire.
caractère de qualité suivant l’accord des parties concernées.
4 Méthodes expérimentales
3.3 Évaluation de la variation de qualité des
ferro-alliages
4.1 Types d’essai
La variation de qualité de chaque type de ferro-alliage est éta-
blie selon l’accord des parties intéressées. 4.1.1 Type 1, pour ferro-alliages échantillonnés par la
méthode au hasard
3.4 Livraisons pour essai
Ce type d’essai est applicable aux ferro-alliages livrés en vrac.
La valeur de la variation de qualité d’un ferro-alliage dépend de
4.1.2 Type II, pour ferro-alliages échantillonnés par la
la méthode de constitution de cette livraison. En fonction du
méthode à deux degrés
procédé de fabrication et du type de ferro-alliage, trois métho-
des peuvent être utilisées, ce sont : la méthode des lots par
Ce type d’essai est applicable aux ferro-alliages livrés sous
coulée, la méthode des lots par coulées regroupées par nuance
emballage.
et la méthode des lots par mélange de coulées.
4.2 Type I
Si la méthode des lots par coulée est utilisée, la valeur de la
variation de qualité a tendance à diminuer et dépend du degré
Méthode appliquée aux ferro-alliages
4.2.1
de concassage et du degré d’homogénéisation du matériau. Si
concassables (voir figure 1)
on expérimente avec les livraisons constituées par cette
méthode, la valeur de la variation de qualité peut être sous-
Cette méthode est applicable aux ferro-alliages dont les prélè-
estimée.
vements élémentaires sont pris à l’aide d’un dispositif d’échan-
tillonnage, tel qu’une pelle.
Si la méthode des lots par coulées regroupées par nuances est
utilisée, la différence entre les coulées constituant une livraison
Dans une livraison de ferro-alliage, au moins dix prélèvements
doit correspondre aux Normes internationales appropriées rela-
élémentaires doivent être effectués.
tives aux conditions techniques de livraison.
Les échantillons dédoublés pour essai doivent être préparés à
La variation de qualité d’une livraison ayant une autre diffé-
partir de chaque prélèvement élémentaire.
rente entre les coulées peut être déterminée suivant l’accord
mutuel entre les parties concernées.
Une détermination chimique isolée du caractére de qualité doit
être effectuée sur chaque échantillon pour essai; l’ordre
d’analyse des échantillons est arbitraire.
II est recommandé de déterminer la variation de qualité sur les
livraisons constituées par méthode des lots par coulées regrou-
Les données expérimentales doivent être portées sur une forme
pées par nuances afin d’obtenir l’évaluation de la variation de
appropriée, comme indiqué sur le tableau 1 donné à titre
qualité la plus solide.
d’exemple.
3.5 Méthodes d’échantillonnage et d’analyse
4.2.2 Méthode appliquée aux ferro-alliages non
chimique
concassables (voir figure 2)
Le prélèvement, la préparation des échantillons et l’analyse chi- Cette méthode est applicable aux ferro-alliages dont les prélè-
vements élémentaires sont obtenus sous forme de copeaux, à
mique pour essai sont effectués conformément aux Normes
internationales appropriées. l’aide d’un dispositif spécial.
2
---------------------- Page: 6 ----------------------
ISO 7087-1984 (FI
De chaque livraison fournie en vrac, doivent être pris au moins Au second degré de l’échantillonnage à deux degrés, quatre
prélèvements élémentaires sous forme de copeaux ou de parti-
dix morceaux.
cules doivent être effectués sur chaque unité d’emballage choi-
sie au premier degré.
Un prélèvement élémentaire sous forme de copeaux doit être
effectué sur chaque morceau prélevé.
Deux sous-échantillons binaires différents désignés par A, B et
C, D, dont chacun se compose de quatre prélèvements élé-
Les échantillons dédoublés pour essai doivent être préparés à
mentaires, doivent être obtenus de la manier-e suivante : A et B
partir de chaque prélèvement élémentaire.
contiennent chacun quatre prélèvements élémentaires effec-
tués un à un sur chacune des unités d’emballage; C contient
Une détermination chimique isolée du caractère de qualité doit
quatre prélèvements élémentaires effectués deux à deux sur les
être effectuée sur chaque échantillon pour essai; l’ordre
deux unités d’emballage paires choisies au premier degré de
d’analyse des échantillons est arbitraire.
l’échantillonnage; D contient quatre prélèvements élémentaires
effectués deux à deux sur les deux unités d’emballage impaires
Les données expérimentales doivent être portées sur une forme
choisies au premier degré de l’échantillonnage.
appropriée, comme indiquée sur le tableau 1 donné à titre
d’exemple.
Les échantillons pour essai doivent être préparés à partir des
sous-échantillons de la maniére suivante : deux échantillons
4.3 Type II pour essai sont obtenus à partir de A et deux à partir de C; un
échantillon pour essai est obtenu à partir de B et un à partir de
Cette méthode est appliquée aux livraisons de ferro-alliages D.
fournis sous emballage, qu’ils soient concassables ou non
concassables (voir figure 3). Une détermination chimique isolée du caractère de qualité doit
être effectuée sur chaque échantillon pour essai; l’ordre
d’analyse des échantillons est arbitraire.
m unités d’emballages doivent être choisies au premier degré
de l’échantillonnage à deux degrés.
Les données expérimentales doivent être portées sur une forme
appropriée, comme indiqué sur le tableau 2 donné à titre
NOTE - II est recommandé d’avoir un nombre m pair pour faciliter le
traitement des données. d’exemple.
3
---------------------- Page: 7 ----------------------
ISO 70874984 (F)
Livraison
Prélévements
élémentaires
(i = 1, 2, . . .
...
Norme internationale
INTERNATIONAL ORGANIZATION FOR STANDARDIZATION.ME~YHAPOAHAR OPTAHM3AlWlR Il0 CTAH~APTH3ALWWORGANISATION INTERNATIONALE DE NORMALISATION
Ferro-alliages - Méthodes expérimentales d’évaluation
de la variation de qualité et méthodes de contrôle de la
fidélité de l’échantillonnage
Ferroallo ys - Experimental methods for the evaluation of the quality variation and methods for checking the precision of sampling
Première édition - 1984-11-01
Réf. no : ISO 70874984 (F)
CDU 669.15498 : 620.11
: ferro-alliage, estimation, qualité, variation, donnée expérimentale, échantillonnage.
Descripteurs
Prix basé sur 13 pages
---------------------- Page: 1 ----------------------
Avant-propos
L’ISO (Organisation internationale de normalisation) est une fédération mondiale
d’organismes nationaux de normalisation (comités membres de I’ISO). L’élaboration
des Normes internationales est confiée aux comités techniques de I’ISO. Chaque
comité membre intéressé par une étude a le droit de faire partie du comité technique
créé à cet effet. Les organisations internationales, gouvernementales et non gouverne-
mentales, en liaison avec I’ISO, participent également aux travaux.
Les projets de Normes internationales adoptés par les comités techniques sont soumis
aux comités membres pour approbation, avant leur acceptation comme Normes inter-
nationales par le Conseil de I’ISO. Les Normes internationales sont approuvées confor-
mément aux procédures de I’ISO qui requiérent l’approbation de 75 % au moins des
comités membres votants.
La Norme internationale ISO 7087 a été élaborée par le comité technique ISO/TC 132,
Ferro-alliages.
Organisation internationale de normalisation, 1984
0
Imprimé en Suisse
---------------------- Page: 2 ----------------------
Sommaire
Page
1
1 Objet et domaine d’application . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
2 Références. 1
1
3 Règles générales pour l’exécution d’un essai. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
1
3.1 Variation de qualité . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
............................................. 2
3.2 Caractère de qualité.
................. 2
3.3 Estimation de la variation de qualité des ferro-alliages
............................................. 2
3.4 Livraisons pour essai
................... 2
3.5 Méthodes d’échantillonnage et d’analyse chimique
................................................ 2
3.6 Nombre d’essais.
2
3.7 Ordre de l’exécution des déterminations chimiques . . . . . . . . . . . . . . . . . . .
............................................. 2
4 Méthodes expérimentales
4.1 Types d’essai . 2
2
4.2 Type1 .
3
4.3 Typell .
9
5 Méthodes d’analyse des données expérimentales . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.1 Choix de la méthode . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
9
5.2 Méthode d’analyse des données pour l’échantillonnage au hasard. . . . . . .
... 9
5.3 Méthode d’analyse des données pour l’échantillonnage à deux degrés
............................................... 10
6 Expression des résultats
........................................ 10
6.1 Échantillonnage au hasard
6.2 Échantillonnage à deux degrés. . 10
................................ 10
7 Évaluation de la fidélité d’échantillonnage
.................... 10
7.1 Méthode utilisée pour l’échantillonnage au hasard
10
7.2 Méthode utilisée pour l’échantillonnage à deux degrés . . . . . . . . . . . . . . . .
7.3 Actions entreprises aprés l’analyse des résultats des essais . . . . . . . . . . . . . 11
Annexe
Exemple de deux autres méthodes de calcul de la variation de qualité
12
(cas d’échantillonnage à deux degrés) pour un essai exécuté sur 10 livraisons. . . . .
. . .
III
---------------------- Page: 3 ----------------------
Page blanche
---------------------- Page: 4 ----------------------
ISO 70874984 (F)
NORME INTERNATIONALE
Méthodes expérimentales d’évaluation
Ferro-alliages -
de la variation de qualité et méthodes de contrôle de la
fidélité de l’échantillonnage
ISO 5449, Ferro-silice-chrome
1 Objet et domaine d’application - Spécifïca tions et conditions
de livraison.
La présente Norme internationale spécifie les méthodes expéri-
mentales d’évaluation de la variation de qualité des ferro- ISO 5450, Ferro-tungstène -
Spécifications et conditions de
alliages afin de déterminer les paramètres de l’échantillonnage livraison.
au hasard et ceux de l’échantillonnage à deux degrés, confor-
mément aux Normes internationales appropriées. Elle spécifie
ISO 5451, Ferro-vanadium
- Spécifications et conditions de
également les méthodes de contrôle de la fidélité de prélève-
livraison.
ment des échantillons par méthode au hasard et par méthode à
deux degrés.
ISO 5452, Ferro-molybdène
- Spécifications et conditions de
livraison.
2 Références
ISO 5453, Ferro-niobium - Spécifications et conditions de
livraison.
Prélèvement et préparation des
ISO 3713, Ferro-alliages -
échantillons - Règles générales. 1)
ISO 5454, Ferro- titane - Spécifications et conditions de
livraison.
Prélèvement et préparation des
ISO 455211, Ferro-alliages -
échantillons pour analyse chimique - Partie 7 : Ferro-chrome,
ISO 7347, Ferro-alliages - Méthodes expérimentales d’évalua-
ferro-silice-chrome, ferro-silicium, ferro-silice-manganèse et
tion de l’erreur systèmatique de prélèvement et de préparation
ferro-manganèse. 1)
des échantillons. 1)
ISO 455212, Ferro-alliages - Prélèvement et préparation des
ISO 7373, Ferro-alliages - Méthodes experimen tales d’évalua-
échantillons pour analayse chimique - Partie 2 : Ferro-titane,
tion de la fidélité de division des échantillons. 1)
ferro-molybdène, ferro- tungstène, ferro-niobium et ferro-
vanadium. 1)
3 Règles générales pour l’exécution d’un
Spécifications et conditions de
ISO 5445, Ferro-silicium -
essai
livraison.
ISO 5446, Ferro-manganèse - Spécifications et conditions de
3.1 Variation de qualité
livraison.
La variation de qualité est la mesure de l’hétérogénéité d’un
I S 0 5447, Ferro-silice-manganèse - Spécifications et condi- ferro-alliage exprimée par l’écart-type et désignée par 0. Pour
tions de livraison. un échantillonnage au hasard, c’est l’écart-type entre les prélè-
vements élémentaires (oi); pour un échantillonnage à deux
ISO 5443, Ferro-chrome - Spécifications et conditions de degrés, ce sont les écarts-types entre les unités d’emballage
livraison.
(~1 et à l’intérieur des unités d’emballage (a,).
1) Actuellement au stade de projet.
---------------------- Page: 5 ----------------------
60 7087-1984 (F)
NOTES 3.6 Nombre d’essais
1 L’échantillonnage au hasard s’applique aux livraisons d’un ferro-
L’essai doit être effectué sur une seule livraison. Pour un
alliage tivré en vrac, qu’il soit concassable ou non concassable.
échantillonnage simple au hasard, l’essai peut être effectué sur
une livraison toute entière ou sur une partie de livraison. Pour
2 L’échantillonnage à deux degrés s’applique aux livraisons fournies
un échantillonnage à deux degrés, l’essai devrait être effectué
sous emballage.
sur m unités d’emballage choisies parmi A4 unités de la livrai-
son.
3.2 Caractère de qualité
Cet essai doit être répété au moins 10 fois.
Le caract&re de qualité pour déterminer la variation de qualité
est donné dans les Normes internationales appropriées relatives 3.7 Ordre de l’exécution des déterminations
aux méthodes d’échantillonnage des ferro-alliages.
chimiques
La succession des déterminations chimiques effectuées sur une
La teneur de n’importe quel autre élément peut être prise pour
série d’échantillons expérimentaux pour essai est arbitraire.
caractère de qualité suivant l’accord des parties concernées.
4 Méthodes expérimentales
3.3 Évaluation de la variation de qualité des
ferro-alliages
4.1 Types d’essai
La variation de qualité de chaque type de ferro-alliage est éta-
blie selon l’accord des parties intéressées. 4.1.1 Type 1, pour ferro-alliages échantillonnés par la
méthode au hasard
3.4 Livraisons pour essai
Ce type d’essai est applicable aux ferro-alliages livrés en vrac.
La valeur de la variation de qualité d’un ferro-alliage dépend de
4.1.2 Type II, pour ferro-alliages échantillonnés par la
la méthode de constitution de cette livraison. En fonction du
méthode à deux degrés
procédé de fabrication et du type de ferro-alliage, trois métho-
des peuvent être utilisées, ce sont : la méthode des lots par
Ce type d’essai est applicable aux ferro-alliages livrés sous
coulée, la méthode des lots par coulées regroupées par nuance
emballage.
et la méthode des lots par mélange de coulées.
4.2 Type I
Si la méthode des lots par coulée est utilisée, la valeur de la
variation de qualité a tendance à diminuer et dépend du degré
Méthode appliquée aux ferro-alliages
4.2.1
de concassage et du degré d’homogénéisation du matériau. Si
concassables (voir figure 1)
on expérimente avec les livraisons constituées par cette
méthode, la valeur de la variation de qualité peut être sous-
Cette méthode est applicable aux ferro-alliages dont les prélè-
estimée.
vements élémentaires sont pris à l’aide d’un dispositif d’échan-
tillonnage, tel qu’une pelle.
Si la méthode des lots par coulées regroupées par nuances est
utilisée, la différence entre les coulées constituant une livraison
Dans une livraison de ferro-alliage, au moins dix prélèvements
doit correspondre aux Normes internationales appropriées rela-
élémentaires doivent être effectués.
tives aux conditions techniques de livraison.
Les échantillons dédoublés pour essai doivent être préparés à
La variation de qualité d’une livraison ayant une autre diffé-
partir de chaque prélèvement élémentaire.
rente entre les coulées peut être déterminée suivant l’accord
mutuel entre les parties concernées.
Une détermination chimique isolée du caractére de qualité doit
être effectuée sur chaque échantillon pour essai; l’ordre
d’analyse des échantillons est arbitraire.
II est recommandé de déterminer la variation de qualité sur les
livraisons constituées par méthode des lots par coulées regrou-
Les données expérimentales doivent être portées sur une forme
pées par nuances afin d’obtenir l’évaluation de la variation de
appropriée, comme indiqué sur le tableau 1 donné à titre
qualité la plus solide.
d’exemple.
3.5 Méthodes d’échantillonnage et d’analyse
4.2.2 Méthode appliquée aux ferro-alliages non
chimique
concassables (voir figure 2)
Le prélèvement, la préparation des échantillons et l’analyse chi- Cette méthode est applicable aux ferro-alliages dont les prélè-
vements élémentaires sont obtenus sous forme de copeaux, à
mique pour essai sont effectués conformément aux Normes
internationales appropriées. l’aide d’un dispositif spécial.
2
---------------------- Page: 6 ----------------------
ISO 7087-1984 (FI
De chaque livraison fournie en vrac, doivent être pris au moins Au second degré de l’échantillonnage à deux degrés, quatre
prélèvements élémentaires sous forme de copeaux ou de parti-
dix morceaux.
cules doivent être effectués sur chaque unité d’emballage choi-
sie au premier degré.
Un prélèvement élémentaire sous forme de copeaux doit être
effectué sur chaque morceau prélevé.
Deux sous-échantillons binaires différents désignés par A, B et
C, D, dont chacun se compose de quatre prélèvements élé-
Les échantillons dédoublés pour essai doivent être préparés à
mentaires, doivent être obtenus de la manier-e suivante : A et B
partir de chaque prélèvement élémentaire.
contiennent chacun quatre prélèvements élémentaires effec-
tués un à un sur chacune des unités d’emballage; C contient
Une détermination chimique isolée du caractère de qualité doit
quatre prélèvements élémentaires effectués deux à deux sur les
être effectuée sur chaque échantillon pour essai; l’ordre
deux unités d’emballage paires choisies au premier degré de
d’analyse des échantillons est arbitraire.
l’échantillonnage; D contient quatre prélèvements élémentaires
effectués deux à deux sur les deux unités d’emballage impaires
Les données expérimentales doivent être portées sur une forme
choisies au premier degré de l’échantillonnage.
appropriée, comme indiquée sur le tableau 1 donné à titre
d’exemple.
Les échantillons pour essai doivent être préparés à partir des
sous-échantillons de la maniére suivante : deux échantillons
4.3 Type II pour essai sont obtenus à partir de A et deux à partir de C; un
échantillon pour essai est obtenu à partir de B et un à partir de
Cette méthode est appliquée aux livraisons de ferro-alliages D.
fournis sous emballage, qu’ils soient concassables ou non
concassables (voir figure 3). Une détermination chimique isolée du caractère de qualité doit
être effectuée sur chaque échantillon pour essai; l’ordre
d’analyse des échantillons est arbitraire.
m unités d’emballages doivent être choisies au premier degré
de l’échantillonnage à deux degrés.
Les données expérimentales doivent être portées sur une forme
appropriée, comme indiqué sur le tableau 2 donné à titre
NOTE - II est recommandé d’avoir un nombre m pair pour faciliter le
traitement des données. d’exemple.
3
---------------------- Page: 7 ----------------------
ISO 70874984 (F)
Livraison
Prélévements
élémentaires
(i = 1, 2, . . .
...
Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.