EN 15368:2008/FprA1

Hydraulic binder for non-structural applications: definition, specifications and conformity criteria

This European Standard applies to Hydraulic binder for non-structural applications in construction used as binder for preparation of mortar or masonry, rendering and plastering and other non structural construction products.
This European Standard specifies the definition and composition of Hydraulic binder for non-structural applications (HB). It includes physical, mechanical and chemical requirements and defines strength classes. EN 15368 also states the conformity criteria and the related rules. Necessary durability requirements are also given.
NOTE   For normal applications the information given in this standard, and in the masonry specifications, EN 998-1 and EN 998-2, is generally sufficient. However, in special cases, an exchange of additional information between the producer and user can be helpful. The details of such an exchange are not within the scope of this standard but should be dealt with in accordance with national standards or other regulations or can be agreed between the parties concerned.
Terms of delivery or other contractual conditions, normally included in documents exchanged between the supplier and the purchaser of Hydraulic binder for non-structural applications, are outside the scope of this European Standard.

Hydraulisches Bindemittel für nichttragende Anwendungen - Definition, Anforderungen und Konformitätskriterien

Liant hydraulique pour applications non structurelles - Définition, spécifications et critères de conformité

Hidravlično vezivo za nekonstrukcijsko uporabo: definicija, specifikacije in merila skladnosti

General Information

• Status: Not Published
• ICS: 91.100.10 - Cement. Gypsum. Lime. Mortar
• ICS: 91.100.50 - Binders. Sealing materials
• Technical Committee: CEN/TC 51 - Cement and building limes
• Drafting Committee: CEN/TC 51/WG 6 - Definitions and terminology of cement
• Current Stage: 5060 - Closure of Vote - Formal Approval
• Start Date: 22-Mar-2010
• Due Date: 17-Oct-2010
• Completion Date: 22-Mar-2010
• Directive: 305/2011 - Regulation (eu) No 305/2011 of the European Parliament and of the Council of 9 march 2011 laying down harmonised conditions for the marketing of construction products and repealing council directive 89/106/eec
• Directive: 89/106/EEC - Construction products
• Mandate: M/114 - Mandate to CEN/CENELEC concerning the execution of standardization work for harmonized standards on cements, buliding limes, and other hydr. binders
• Mandate: M/116 - Mandate to CEN/CENELEC concerning the execution of standardization work for harmonized standards on masonry and related products
• Ref Project: SIST EN 15368:2008/kprA1:2009 - Hydraulic binder for non-structural applications: definition, specifications and conformity criteria

Relations

• Merged Into: EN 15368:2008+A1:2010 - Hydraulic binder for non-structural applications - Definition, specifications and conformity criteria
• Effective Date: 27-Mar-2010
• Amends: EN 15368:2008 - Hydraulic binder for non-structural applications: definition, specifications and conformity criteria
• Effective Date: 08-Apr-2009

Overview

EN 15368:2008/FprA1 is a CEN European Standard that defines hydraulic binder for non‑structural applications (HB) used in construction as binders for mortar, masonry, rendering, plastering and other non‑structural products. The standard specifies definition and composition, sets physical, mechanical and chemical requirements, defines strength classes and includes durability requirements. It also establishes conformity criteria and procedures for CE marking and factory production control under the EU Construction Products framework (Annex ZA).

Key Topics and Technical Requirements

• Definition and composition: scope and permitted constituents for hydraulic binders intended for non‑structural use.
• Physical and mechanical requirements: properties such as fineness (sieve residue), setting time, and compressive strength (strength classes are defined).
• Chemical and soundness limits: parameters including SO3 content and expansion (soundness) requirements.
• Fresh mortar properties: air content and water retention requirements to ensure workability and performance in masonry and rendering.
• Durability: necessary durability criteria for intended non‑structural uses.
• Conformity and assessment: factory production control (FPC), initial type testing (ITT), and attestation systems (notably System 2 and System 2+) for CE marking. Annex ZA relates clauses of EN 15368 to Construction Products Directive requirements and details documentation, CE marking information and declaration/certification processes.

Applications and Who Uses This Standard

• Practical applications: specification and quality control of binders used in preparing mortar for masonry, rendering, plastering, and other non‑structural construction products.
• Typical users:
  • Binder and cement manufacturers - to develop products that meet European requirements and obtain CE marking.
  • Product specifiers and façade/brickwork contractors - to select appropriate HB grades and strength classes for non‑structural works.
  • Testing and certification bodies - to perform initial type testing, FPC assessment and conformity certification (Systems 2 / 2+).
  • Regulators and procurement teams - to interpret declared performance, durability and CE marking information.
• Note: For routine masonry practice, EN 15368 together with masonry standards EN 998‑1 and EN 998‑2 usually provide sufficient guidance; special cases may require additional supplier–user exchange.

Related Standards

• EN 998‑1 and EN 998‑2 (mortar and masonry specifications) - commonly used alongside EN 15368.
• Annex ZA of EN 15368 links the standard to the EU Construction Products Directive and CE marking procedures.

Keywords: EN 15368, hydraulic binder, non‑structural applications, mortar, masonry, rendering, plastering, conformity, CE marking, factory production control.

Standards Content (Sample)

SLOVENSKI STANDARD
01-december-2009
+LGUDYOLþQRYH]LYR]DQHNRQVWUXNFLMVNRXSRUDERGHILQLFLMDVSHFLILNDFLMHLQPHULOD
VNODGQRVWL
Hydraulic binder for non-structural applications: definition, specifications and conformity
criteria
Hydraulisches Bindemittel für nichttragende Anwendungen - Definition, Anforderungen
und Konformitätskriterien
Liant hydraulique pour applications non structurelles - Définition, spécifications et critères
de conformité
Ta slovenski standard je istoveten z: EN 15368:2008/FprA1
ICS:
91.100.50 Veziva. Tesnilni materiali Binders. Sealing materials
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.

EUROPEAN STANDARD
FINAL DRAFT
EN 15368:2008
NORME EUROPÉENNE
EUROPÄISCHE NORM
prA1
October 2009
ICS 91.100.50
English Version
Hydraulic binder for non-structural applications: definition,
specifications and conformity criteria
Liant hydraulique pour applications non structurelles - Hydraulisches Bindemittel für nichttragende Anwendungen
Définition, spécifications et critères de conformité - Definition, Anforderungen und Konformitätskriterien
This draft amendment is submitted to CEN members for unique acceptance procedure. It has been drawn up by the Technical Committee
CEN/TC 51.
This draft amendment A1, if approved, will modify the European Standard EN 15368:2008. If this draft becomes an amendment, CEN
members are bound to comply with the CEN/CENELEC Internal Regulations which stipulate the conditions for inclusion of this amendment
into the relevant national standard without any alteration.

This draft amendment was established by CEN in three official versions (English, French, German). A version in any other language made
by translation under the responsibility of a CEN member into its own language and notified to the CEN Management Centre has the same
status as the official versions.

CEN members are the national standards bodies of Austria, Belgium, Bulgaria, Cyprus, Czech Republic, Denmark, Estonia, Finland,
France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, Netherlands, Norway, Poland, Portugal,
Romania, Slovakia, Slovenia, Spain, Sweden, Switzerland and United Kingdom.

Warning : This document is not a European Standard. It is distributed for review and comments. It is subject to change without notice and
shall not be referred to as a European Standard.

EUROPEAN COMMITTEE FOR STANDARDIZATION
COMITÉ EUROPÉEN DE NORMALISATION

EUROPÄISCHES KOMITEE FÜR NORMUNG

Management Centre: Avenue Marnix 17, B-1000 Brussels
© 2009 CEN All rights of exploitation in any form and by any means reserved Ref. No. EN 15368:2008/FprA1:2009: E
worldwide for CEN national Members.

Contents Page
Foreword .3
1 Modification to the Foreword .4
2 Addition of Annex ZA .4

Foreword
This document (EN 15368:2008/FprA1:2009) has been prepared by Technical Committee CEN/TC 51
"Cement and building limes", the secretariat of which is held by NBN.
This document is currently submitted to the Unique Acceptance Procedure.
This document has been prepared under a mandate given to CEN by the European Commission and the
European Free Trade Association, and supports essential requirements of EU Directive(s).
For relationship with EU Directive(s), see informative Annex ZA, which is an integral part of this document.
1 Modification to the Foreword
Add the following paragraphs before the last paragraph:
"This document has been prepared under a mandate given to CEN by the European Commission and the
European Free Trade Association, and supports essential requirements of EU Directive(s).
For relationship with EU Directive(s), see informative Annex ZA, which is an integral part of this document.".
2 Addition of Annex ZA
Add the following Annex ZA: "
Annex ZA
(informative)
Clauses of this European Standard addressing the provisions of the EU
Construction Products Directive
ZA.1 Scope and relevant characteristics
This European Standard has been prepared under Mandate M114 cements, building limes, and other
hydraulic binders given to CEN by the European Commission and the European Free Trade Association.
The clauses of this European Standard shown in this annex meet the requirements of the mandate given
under the EU Construction Products Directive (89/106/EEC).
Compliance with these clauses confers a presumption of fitness of the hydraulic binders covered by this
annex for the intended uses indicated herein; reference shall be made to the information accompanying the
CE marking.
WARNING — Other requirements and other EU Directives, not affecting the fitness for intended uses,
can be applicable to the Hydraulic binders for masonry falling within the scope of this European
Standard.
NOTE 1 In addition to any specific clauses relating to dangerous substances contained in this standard, there may be
other requirements applicable to the products falling within its scope (e.g. transposed European legislation and national
laws, regulations and administrative provisions). In order to meet the provisions of the EU Construction Products Directive,
these requirements need also to be complied with, when and where they apply.
NOTE 2 An informative database of European and national provisions on dangerous substances is available at the
Construction web site on EUROPA (accessed through
http://ec.europa.eu/enterprise/construction/internal/dangsub/dangmain_en.htm )
This annex establishes the conditions for the CE marking of the hydraulic binders intended for the uses
indicated in Table ZA.1 and shows the relevant clauses applicable.
This annex has the same scope as Clause 1 of this standard and is defined by TableZA.1.
Table ZA.1 — Relevant clauses for hydraulic binders and intended use
Product: Hydraulic binder for non structural application as covered under the scope of this standard
Intended use: preparation of mortar for masonry, rendering and plastering and other non structural
construction products
Requirement clauses in
Levels and/or
Essential Characteristics this and other European Notes
classes
Standard(s)
None
Constituents and composition 5.2 Requirement
expressed in
terms of
minimum value
Fineness (sieve residue) 5.3.1 None Requirement
expressed in
terms of upper
limit
Setting time 5.3.2 None Requirement
expressed in
terms of limits
Compressive strength 5.3.5 None Compressive
strength
requirements
expressed in
terms of
strength
classes and
limits
Soundness (expansion and SO3 5.3.3 None Requirement
content) expressed in
terms of upper
limit
Air content 5.3.4 None Requirement
expressed in
terms of upper
and lower limits
Water retention of fresh mortar 5.3.4 None Requirement
expressed in
terms of lower
limit
Durability 6
The requirement on a certain characteristic is not applicable in those Member States (MSs) where there are
no regulatory requirements on that characteristic for the intended use of the product. In this case,
manufacturers placing their products on the market of these MSs are not obliged to determine nor declare the
performance of their products with regard to this characteristic and the option “No performance determined”
(NPD) in the information accompanying the CE marking (see ZA.3) may be used. The NPD option may not be
used, however, where the characteristic is subject to a threshold level.
ZA.2 Procedure for attestation of conformity of hydraulic binder
ZA.2.1 System of attestation of conformity
The system of atte
...