IEC 61158-5-9:2014

Industrial communication networks - Fieldbus specifications - Part 5-9: Application layer service definition - Type 9 elements

IEC 61158-5-9:2014 defines the services provided to the FAL user at the boundary between the user and the application layer of the fieldbus reference model, and Systems Management at the boundary between the application layer and Systems Management of the fieldbus reference model. This standard specifies the structure and services of the IEC fieldbus application layer, in conformance with the OSI Basic Reference Model (ISO/IEC 7498-1) and the OSI application layer structure (ISO/IEC 9545). This second edition cancels and replaces the first edition published in 2007 and constitutes a technical revision. The main changes are: Correct download state machine event service.

Réseaux de communication industriels - Spécifications des bus de terrain - Partie 5-9: Définition des services de la couche application - Eléments de type 9

L'IEC 61158-5-9:2014 défini les services mis en place pour l'utilisateur de FAL, à la frontière entre l'utilisateur et la couche application du modèle de référence de bus de terrain; et la Gestion des systèmes, à la frontière entre la couche application et la Gestion des systèmes selon le modèle de référence de bus de terrain. La présente norme spécifie la structure et les services de la couche application de bus de terrain IEC, en conformité avec le modèle de référence de base de l'OSI (ISO/CEI 7498-1) et la structure de la couche application de l'OSI (ISO/CEI 9545). Cette deuxième édition annule et remplace la première édition parue en 2007. Elle constitue une révision technique. Cette édition inclut les modifications suivantes: Correction des services d'événements du diagramme d'états de téléchargement descendant.

Oprema in sistemi daljinskega vodenja - 1. del: Splošno - 3. oddelek: Slovar (IEC/TR 60870-1-3:1997)

General Information

• Status: Published
• Publication Date: 17-Aug-2014
• ICS: 01.040.33 - Telecommunications. Audio and video engineering (Vocabularies)
• ICS: 25.040.40 - Industrial process measurement and control
• ICS: 33.200 - Telecontrol. Telemetering
• ICS: 35.100.70 - Application layer
• ICS: 35.110 - Networking
• Technical Committee: SC 65C - Industrial networks
• Current Stage: PPUB - Publication issued
• Start Date: 31-Jul-2014
• Completion Date: 18-Aug-2014
• Ref Project: SIST IEC/TR 60870-1-3:1997 - Telecontrol equipment and systems - Part 1: General considerations - Section 3: Glossary

Relations

• Revises: IEC 61158-5-9:2007 - Industrial communication networks - Fieldbus specifications - Part 5-9: Application layer service definition - Type 9 elements
• Effective Date: 05-Sep-2023

Standards Content (Sample)

IEC 61158-5-9 ®
Edition 2.0 2014-08
INTERNATIONAL
STANDARD
NORME
INTERNATIONALE
Industrial communication networks – Fieldbus specifications –
Part 5-9: Application layer service definition – Type 9 elements

Réseaux de communication industriels – Spécifications des bus de terrain –
Partie 5-9: Définition des services de la couche application – Eléments de type 9

All rights reserved. Unless otherwise specified, no part of this publication may be reproduced or utilized in any form
or by any means, electronic or mechanical, including photocopying and microfilm, without permission in writing from
either IEC or IEC's member National Committee in the country of the requester. If you have any questions about IEC
copyright or have an enquiry about obtaining additional rights to this publication, please contact the address below or
your local IEC member National Committee for further information.

Droits de reproduction réservés. Sauf indication contraire, aucune partie de cette publication ne peut être reproduite
ni utilisée sous quelque forme que ce soit et par aucun procédé, électronique ou mécanique, y compris la photocopie
et les microfilms, sans l'accord écrit de l'IEC ou du Comité national de l'IEC du pays du demandeur. Si vous avez des
questions sur le copyright de l'IEC ou si vous désirez obtenir des droits supplémentaires sur cette publication, utilisez
les coordonnées ci-après ou contactez le Comité national de l'IEC de votre pays de résidence.

IEC Central Office Tel.: [phone]
3, rue de Varembé Fax: [phone]
CH-1211 Geneva 20 [e-mail]
Switzerland www.iec.ch
About the IEC
The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes
International Standards for all electrical, electronic and related technologies.

About IEC publications
The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the
latest edition, a corrigenda or an amendment might have been published.

IEC Catalogue - webstore.iec.ch/catalogue Electropedia - www.electropedia.org
The stand-alone application for consulting the entire The world's leading online dictionary of electronic and
bibliographical information on IEC International Standards, electrical terms containing more than 30 000 terms and
Technical Specifications, Technical Reports and other definitions in English and French, with equivalent terms in 14
documents. Available for PC, Mac OS, Android Tablets and additional languages. Also known as the International
iPad. Electrotechnical Vocabulary (IEV) online.

IEC publications search - www.iec.ch/searchpub IEC Glossary - std.iec.ch/glossary
The advanced search enables to find IEC publications by a More than 55 000 electrotechnical terminology entries in
variety of criteria (reference number, text, technical English and French extracted from the Terms and Definitions
committee,…). It also gives information on projects, replaced clause of IEC publications issued since 2002. Some entries
and withdrawn publications. have been collected from earlier publications of IEC TC 37,

77, 86 and CISPR.
IEC Just Published - webstore.iec.ch/justpublished
Stay up to date on all new IEC publications. Just Published IEC Customer Service Centre - webstore.iec.ch/csc
details all new publications released. Available online and If you wish to give us your feedback on this publication or
also once a month by email. need further assistance, please contact the Customer Service
Centre: [e-mail].
A propos de l'IEC
La Commission Electrotechnique Internationale (IEC) est la première organisation mondiale qui élabore et publie des
Normes internationales pour tout ce qui a trait à l'électricité, à l'électronique et aux technologies apparentées.

A propos des publications IEC
Le contenu technique des publications IEC est constamment revu. Veuillez vous assurer que vous possédez l’édition la
plus récente, un corrigendum ou amendement peut avoir été publié.

Catalogue IEC - webstore.iec.ch/catalogue Electropedia - www.electropedia.org
Application autonome pour consulter tous les renseignements
Le premier dictionnaire en ligne de termes électroniques et
bibliographiques sur les Normes internationales,
électriques. Il contient plus de 30 000 termes et définitions en
Spécifications techniques, Rapports techniques et autres
anglais et en français, ainsi que les termes équivalents dans
documents de l'IEC. Disponible pour PC, Mac OS, tablettes
14 langues additionnelles. Egalement appelé Vocabulaire
Android et iPad.
Electrotechnique International (IEV) en ligne.

Recherche de publications IEC - www.iec.ch/searchpub
Glossaire IEC - std.iec.ch/glossary
Plus de 55 000 entrées terminologiques électrotechniques, en
La recherche avancée permet de trouver des publications IEC
en utilisant différents critères (numéro de référence, texte, anglais et en français, extraites des articles Termes et
comité d’études,…). Elle donne aussi des informations sur les Définitions des publications IEC parues depuis 2002. Plus
projets et les publications remplacées ou retirées. certaines entrées antérieures extraites des publications des

CE 37, 77, 86 et CISPR de l'IEC.
IEC Just Published - webstore.iec.ch/justpublished

Service Clients - webstore.iec.ch/csc
Restez informé sur les nouvelles publications IEC. Just
Published détaille les nouvelles publications parues. Si vous désirez nous donner des commentaires sur cette
Disponible en ligne et aussi une fois par mois par email. publication ou si vous avez des questions contactez-nous:
[e-mail].
IEC 61158-5-9 ®
Edition 2.0 2014-08
INTERNATIONAL
STANDARD
NORME
INTERNATIONALE
Industrial communication networks – Fieldbus specifications –

Part 5-9: Application layer service definition – Type 9 elements

Réseaux de communication industriels – Spécifications des bus de terrain –

Partie 5-9: Définition des services de la couche application – Eléments de type 9

INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
COMMISSION
ELECTROTECHNIQUE
PRICE CODE
INTERNATIONALE
CODE PRIX XF
ICS 25.040.40; 35.100.70; 35.110 ISBN 978-2-8322-1735-1

– 2 – IEC 61158-5-9:2014 © IEC 2014
CONTENTS
FOREWORD . 5
INTRODUCTION . 7
1 Scope . 8
1.1 General . 8
1.2 Specifications . 9
1.3 Conformance . 9
2 Normative references . 9
3 Terms, definitions, symbols, abbreviations and conventions . 10
3.1 ISO/IEC 7498-1 terms . 10
3.2 ISO/IEC 8822 terms . 10
3.3 ISO/IEC 9545 terms . 10
3.4 ISO/IEC 8824-1 terms . 10
3.5 IEC 61158-1 terms . 10
3.6 Type 9 fieldbus application-layer specific definitions. 14
3.7 Abbreviations and symbols . 14
3.8 Conventions . 15
4 Concepts . 18
5 Data type ASE . 18
5.1 Overview . 18
5.2 Formal definition of data type objects . 21
5.3 FAL defined data types . 22
5.4 Data type ASE service specification . 25
5.5 Summary of data types . 25
6 Communication model specification . 26
6.1 Concepts . 26
6.2 Common parameters . 26
6.3 ASEs . 26
6.4 ARs . 115
6.5 Summary of classes . 118
6.6 Permitted services by AREP role . 119

Bibliography . 121

Figure 1 – Data type class hierarchy . 19
Figure 2 – VFD model . 27
Figure 3 – Abstract model of an automation system (VFD) . 27
Figure 4 – Source OD/remote OD . 33
Figure 5 – Put OD state machine . 46
Figure 6 – Transaction object state machine . 52
Figure 7 – Context test of two features-supported with different bitstring length . 60
Figure 8 – Overview of event . 80
Figure 9 – Event state machine . 85
Figure 10 – Domain genericdownload/download state machine (server) . 100
Figure 11 – Domain upload state machine (server) . 102
Figure 12 – State diagram. 113

Table 1 – Data type summary . 26
Table 2 – Logical status . 28
Table 3 – Status . 29
Table 4 – Unsolicited status . 30
Table 5 – Identify . 31
Table 6 – Structure of the object dictionary . 34
Table 7 – Structure of the static list of types . 34
Table 8 – Structure of the static object dictionary . 34
Table 9 – Structure of the dynamic list of variable lists . 35
Table 10 – Structure of the dynamic list of program invocations . 35
Table 11 – Empty object dictionary . 39
Table 12 – Get OD service parameters . 42
Table 13 – Initiate put OD service parameters . 44
Table 14 – Put OD service parameters . 45
Table 15 – Terminate put OD service parameters . 46
Table 16 – Put OD state transitions . 48
Table 17 – Attribute FMS features supported . 50
Table 18 – Transaction object state transitions . 53
Table 19 – Initiate service parameters . 54
Table 20 – Failure reasons .
...

SLOVENSKI STANDARD
01-avgust-1997
Oprema in sistemi daljinskega vodenja - 1. del: Splošno - 3. oddelek: Slovar
(IEC/TR 60870-1-3:1997)
Telecontrol equipment and systems - Part 1: General considerations - Section 3:
Glossary
Matériels et systèmes de téléconduite - Partie 1: Considérations générales - Section 3:
Glossaire
Ta slovenski standard je istoveten z: IEC/TR 60870-1-3
ICS:
01.040.33 Telekomunikacije. Avdio in Telecommunications. Audio
video tehnika (Slovarji) and video engineering
(Vocabularies)
33.200 Daljinsko krmiljenje, daljinske Telecontrol. Telemetering
meritve (telemetrija)
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.

RAPPORT
CEI
TECHNIQUE – TYPE 3
IEC
60870-1-3
TECHNICAL
Deuxième édition
REPORT – TYPE 3
Second edition
1997-04
Matériels et systèmes de téléconduite –
Partie 1:
Considérations générales –
Section 3: Glossaire
Telecontrol equipment and systems –
Part 1:
General considerations –
Section 3: Glossary
 IEC 1997 Droits de reproduction réservés  Copyright - all rights reserved
Aucune partie de cette publication ne peut être reproduite ni utilisée No part of this publication may be reproduced or utilized in
sous quelque forme que ce soit et par aucun procédé, électronique any form or by any means, electronic or mechanical, including
ou mécanique, y compris la photocopie et les microfilms, sans photocopying and microfilm, without permission in writing from
l'accord écrit de l'éditeur. the publisher.
International Electrotechnical Commission 3, rue de Varembé Geneva, Switzerland
Telefax: [phone] e-mail: [e-mail] IEC web site http: //www.iec.ch
CODE PRIX
Commission Electrotechnique Internationale
PRICE CODE W
International Electrotechnical Commission
Pour prix, voir catalogue en vigueur
For price, see current catalogue

60870-1-3 © IEC: 1997 – 3 –
CONTENTS
Page
FOREWORD . 5
INTRODUCTION . 9
Clause
1 Scope and object . 11
2 Reference documents . 11
3 Definitions. 15 to 75

60870-1-3 © IEC: 1997 – 5 –
INTERNATIONAL ELECTROTECHNICAL COMMISSION
––––––––
TELECONTROL EQUIPMENT AND SYSTEMS –
Part 1: General considerations –
Section 3: Glossary
FOREWORD
1) The IEC (International Electrotechnical Commission) is a worldwide organization for standardization comprising
all national electrotechnical committees (IEC National Committees). The object of the IEC is to promote
international co-operation on all questions concerning standardization in the electrical and electronic fields. To
this end and in addition to other activities, the IEC publishes International Standards. Their preparation is
entrusted to technical committees; any IEC National Committee interested in the subject dealt with may
participate in this preparatory work. International, governmental and non-governmental organizations liaising
with the IEC also participate in this preparation. The IEC collaborates closely with the International Organization
for Standardization (ISO) in accordance with conditions determined by agreement between the two
organizations.
2) The formal decisions or agreements of the IEC on technical matters express, as nearly as possible, an
international consensus of opinion on the relevant subjects since each technical committee has representation
from all interested National Committees.
3) The documents produced have the form of recommendations for international use and are published in the form
of standards, technical reports or guides and they are accepted by the National Committees in that sense.
4) In order to promote international unification, IEC National Committees undertake to apply IEC International
Standards transparently to the maximum extent possible in their national and regional standards. Any
divergence between the IEC Standard and the corresponding national or regional standard shall be clearly
indicated in the latter.
5) The IEC provides no marking procedure to indicate its approval and cannot be rendered responsible for any
equipment declared to be in conformity with one of its standards.
6) Attention is drawn to the possibility that some of the elements of this International Standard may be the subject
of patent rights. The IEC shall not be held responsible for identifying any or all such patent rights.
The main task of IEC technical committees is to prepare International Standards. In
exceptional circumstances, a technical committee may propose the publication of a technical
report of one of the following types:
• type 1, when the required support cannot be obtained for the publication of an
International Standard, despite repeated efforts;
• type 2, when the subject is still under technical development or where for any other
reason there is the future but no immediate possibility of an agreement on an International
Standard;
• type 3, when a technical committee has collected data of a different kind from that
which is normally published as an International Standard, for example "state of the art".
Technical reports of types 1 and 2 are subject to review within three years of publication to
decide whether they can be transformed into International Standards. Technical reports of
type 3 do not necessarily have to be reviewed until the data they provide are considered to be
no longer valid or useful.
60870-1-3 © IEC: 1997 – 7 –
IEC 60870-1-3, which is a technical report of type 3, has been prepared by IEC technical
committee 57: Power system control and associated communications.
This second edition cancels and replaces the first edition published in 1990 and constitutes a
technical revision.
The text of this technical report is based on the following documents:
Committee draft Report on voting
57(Sec)171 57/297/RVC
Full information on the voting for the approval of this technical report can be found in the report
on voting indicated in the above table.

60870-1-3 © IEC: 1997 – 9 –
INTRODUCTION
Standards and reports on telecontrol equipment and systems produced during the last few
years by IEC technical committee 57 in different documents of series IEC 60870-5 and
IEC 60870-6 use a certain number of terms with specific meanings in telecontrol applications
that are not yet defined in IEC 60050(371): International Electrotechnical Vocabulary (IEV) –
Chapter 371: Telecontrol (1984). In most of the documents of the 60870 series, glossaries
related to the particular document already exist. Nevertheless, the collection of relevant terms
in this document is useful for the reader of the above-mentioned documents.
This section of IEC 60870-1 presents in alphabetic order these terms and their definitions. It
also presents a comprehensive means of referring to terms with particular meaning in
telecontrol systems and equipment that should also be used in future telecontrol
documentation.
60870-1-3 © IEC: 1997 – 11 –
TELECONTROL EQUIPMENT AND SYSTEMS –
Part 1: General considerations –
Section 3: Glossary
1 Scope and object
This technical report applies to telecontrol equipment and systems with coded bit serial data
transmission for monitoring and control of geographically widespread processes.
This section of IEC 60870-1 covers those terms which are specifically relevant to telecontrol
techniques as well as other terms which are necessary for the understanding of telecontrol
standards.
This report also gives, where applicable, references to other dictionaries of electrical and
electronic terms.
Terms which are considered to be well known by readers of telecontrol standards are not
included in this report. This applies particularly in the field of communications where such
terms as, for example, "information" and "bit" are commonplace and well understood.
2 Reference documents
The following standards contain provisions which, through reference in this text, constitute
provisions of this section of the IEC 60870 series. At the time of publication, the editions of the
reference documents indicated were valid. All standards are subject to revision, so readers are
encouraged to investigate the possibility of applying the most recent editions of the standards
indicated below. Members of IEC and ISO maintain registers of currently valid International
Standards.
IEC 60050(191): 1990, International Electrotechnical Vocabulary (IEV) – Chapter 191:
Dependability and quality of service
IEC 60050(351): 1997, International Electrotechnical Vocabulary (IEV) – Chapter 351:
Automatic control
IEC 60050(371): 1984, International Electrotechnical Vocabulary (IEV) – Chapter 371:
Telecontrol
IEC 60050(721): 1992, International Electrotechnical Vocabulary (IEV) – Chapter 721:
Telegraphy, facsimile and data communication
IEC 60870-1-4: 1994, Telecontrol equipment and systems – Part 1: General considerations –
Section 4: Basic aspects of telecontrol data transmission and organization of standards
IEC 60870-5 and IEC 60870-6
IEC 60870-2-1: 1995, Telecontrol equipment and systems – Part 2: Operating conditions –
Section 1: Power supply and electromagnetic compatibility
IEC 60870-5-3: 1992, Telecontrol equipment and systems – Part 5: Transmission protocols –
Section 3: General structure of application data

60870-1-3 © IEC: 1997 – 13 –
IEC 60870-5-4: 1993, Telecontrol equipment and systems – Part 5: Transmission protocols –
Section 4: Definition and coding of application information elements
IEC 60870-5-5: 1995, Telecontrol equipment and systems – Part 5: Transmission protocols –
Section 5: Basic application functions
IEC 60870-5-101: 1995, Telecontrol equipment and systems – Part 5: Transmission protocols –
Section 101: Companion standard for basic telecontrol tasks
IEC 60870-6-501: 1995, Telecontrol equipment and systems – Part 6: Telecontrol protocols
compatible with ISO standards and ITU-T recommendations – Section 501: TASE.1 Service
definitions
IEC 60870-6-502: 1995, Telecontrol equipment and systems – Part 6: Telecontrol protocols
compatible with ISO standards and ITU-T recommendations – Section 502: TASE.1 Protocol
definitions
ISO/IEC 2382-9: 1995, Information technology – Vocabulary – Part 9: Data communication
ISO/IEC 3309: 1993, Information technology – Telecommunications and information exchange
between systems – High-level data link control (HDLC) procedures – Frame structure
ISO/IEC 4335: 1993, Information technology – Telecommunications and information exchange
between systems – High-level data link control (HDLC) procedures – Elements of procedures
ISO 7498-1: 1994, Information technology – Open Systems Interconnection – Basic Reference
Model: The Basic Model
ISO 7498-2: 1989, Information processing systems – Open Systems Interconnection – Basic
Reference Model – Part 2: Security Architecture
ISO 8326: 1987, Information processing systems – Open Systems Interconnection – Basic
connection oriented session service definition
ISO TR 8509: 1987, Information processing systems – Open Systems Interconnection –
Service conventions
ISO 8648: 1988, Information processing systems – Open Systems Interconnection – Internal
organization of the Network Layer
ISO/IEC 8824: 1990, Information technology – Open Systems Interconnection – Specification
of Abstract Syntax Notation One (ASN.1)
ISO/IEC 9545: 1994, Information technology – Open Systems Interconnection – Application
Layer structure
ISO/IEC 9646-1: 1994, Information technology – Open Systems Interconnection – Conformance
testing methodology and framework – Part 1: General concepts
ISO/IEC TR 10000-1: 1995, Information technology – Framework and taxonomy of International
Standarized Profiles – Part 1: General principles and documentation
ISO/IEC TR 10000-2: 1995, Information technology – Framework and taxonomy of International
Standarized Profiles – Part 2: Principles and Taxonomy for OSI Profiles
ITU-T X.15: 1984, Definition of terms concerning public data networks

60870-1-3 © IEC: 1997 – 15 –
3 Definitions
absolute chronology; time tagging: Method of transmission of changes-of-state so that
transmitted information is accompanied by data giving the registered time at which the change
occurred, within the time resolution. [IEV 371-05-02]
acknowledgement: See positive acknowledgement; negative acknowledgement
acquisition time: Minimum time for correct detection and processing of a change-of-state.
address: Part of a message identifying the source or its destination.
adjusting command: Command used to change the state of operational equipment having
more than two states. [IEV 371-03-10]
alarm: Information for attracting attention to some abnormal state.
NOTE – A transition from a normal into an abnormal state causes a visual and/or audible warning which has to
be acknowledged. A transition from an abnormal into a normal state usually causes a change of indication and,
in some applications, also causes a visual and/or audible warning which has to be acknowledged.
analogue signal: Signal in the form of a continuously variable value.
application association: Co-operative relationship between two application-service-object-
invocations which govern their bilateral use of the Presentation Service for communication of
information and co-ordination of their joint operation. [ISO/IEC 9545]
application entity (AE): Aspects of an application-process pertinent to Open Systems
Interconnection (OSI). [ISO 7498]
application functions: Functions covering the special needs of the process to which a
telecontrol or SCADA system is applied.
The application functions are divided into basic functions and extended processing functions.
application functions (in the sense of the basic reference model): Part of application-
processes which performs the remote communications pr
...

6/29(16.,6,67,(&7567$1'$5'DYJXVW2SUHPDLQVLVWHPLGDOMLQVNHJDYRGHQMD±GHO6SORãQR±RGGHOHN6ORYDULVWRYHWHQ],(&757HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW*HQHUDOFRQVLGHUDWLRQV±6HFWLRQ*ORVVDU\0DWpULHOVHWV\VWqPHVGHWpOpFRQGXLWH±3DUWLH&RQVLGpUDWLRQVJpQpUDOHV±6HFWLRQ*ORVVDLUH5HIHUHQþQDR]QDND,&66,67,(&75VO1DGDOMHYDQMHQDVWUDQHKRGGR !"! #$%&'()* $)
+" $)# ) ,! -.!"!/! $%
6,67,(&751$&,21$/1,892'7HKQLþQRSRURþLOR6,67,(&75VO2SUHPDLQVLVWHPLGDOMLQVNHJDYRGHQMD±GHO6SORãQR±RGGHOHN6ORYDULPDVWDWXVVORYHQVNHJDWHKQLþQHJDSRURþLODLQMHLVWRYHWQR]PHGQDURGQLPWHKQLþQLPSRURþLORP,(&75HQ7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW*HQHUDOFRQVLGHUDWLRQV±6HFWLRQ*ORVVDU\1$&,21$/1,35('*29250HGQDURGQRWHKQLþQRSRURþLOR,(&75MHSULSUDYLOWHKQLþQLRGERU0HGQDURGQHHOHNWURWHKQLãNHNRPLVLMH,(&7&9RGHQMHLQWHOHNRPXQLNDFLMHYHQHUJHWLNL6ORYHQVNRWHKQLþQRSRURþLOR6,67,(&75MHSUHYRGPHGQDURGQHJDWHKQLþQHJDSRURþLOD,(&759SULPHUXVSRUDJOHGHEHVHGLODVORYHQVNHJDSUHYRGDYWHPWHKQLþQHPSRURþLOXMHRGORþLOQRL]YLUQRPHGQDURGQRWHKQLþQRSRURþLORYDQJOHãNHPMH]LNX6ORYHQVNRL]GDMRWHKQLþQHJDSRURþLODMHSULSUDYLOWHKQLþQLRGERU6,677&97(9RGHQMHLQWHOHNRPXQLNDFLMHYHQHUJHWLNL2GORþLWHY]DSULY]HPWHJDPHGQDURGQHJDWHKQLþQHJDSRURþLODMHDYJXVWDVSUHMHOWHKQLþQLRGERU6,677&97(9RGHQMHLQWHOHNRPXQLNDFLMHYHQHUJHWLNL26129$=$,='$-267$1'$5'$±3ULY]HPWHKQLþQHJDSRURþLOD,(&752320%$±1DFLRQDOQLXYRGLQQDFLRQDOQLSUHGJRYRUQLVWDVHVWDYQLGHOVWDQGDUGD

6,67,(&759HOMDYQRVWWHSXEOLNDFLMH,(&VWDOQRSUHJOHGXMHWHKQLþQRYVHELQRSXEOLNDFLM,(&NDU]DJRWDYOMDGDYVHELQDRGUDåD]DGQMHVWDQMHWHKQLNH,QIRUPDFLMHRGDWXPXSRWUGLWYHSXEOLNDFLMHVRQDYROMRSULFHQWUDOQHPXUDGX,(&,QIRUPDFLMHRGHOXUHYL]LMHLQL]GDMLSUHJOHGDQLK]ELUNWHUGRSROQLWYHVRQDYROMRSULQDFLRQDOQLKNRPLWHMLK,(&LQYQDVOHGQMLKYLULK,(&x,(&%XOOHWLQx,(&
6,67,(&759VHELQD6WUDQ3UHGJRYRU8YRG2EVHJLQSUHGPHWVWDQGDUGD=YH]D]GUXJLPLVWDQGDUGL'HILQLFLMH'RGDWHN1$$EHFHGQLVH]QDPVORYHQVNLKLQDQJOHãNLKL]UD]RY$EHFHGQLVH]QDPDQJOHãNLKLQVORYHQVNLKL]UD]RY3XEOLNDFLMH,(&NLMLKMHSULSUDYLOWHKQLþQLRGERU0HGQDURGQHHOHNWURWHKQLãNHNRPLVLMH,(&7&9RGHQMHLQWHOHNRPXQLNDFLMHYHQHUJHWLNL

6,67,(&7535('*2925,(&0HGQDURGQDHOHNWURWHKQLãNDNRPLVLMDMHVYHWRYQDRUJDQL]DFLMD]DVWDQGDUGL]DFLMRNL]GUXåXMHYVHQDFLRQDOQHHOHNWURWHKQLþQHNRPLWHMHQDFLRQDOQLNRPLWHML,(&&LOM,(&MHSRVSHãHYDWLPHGQDURGQRVRGHORYDQMHYYVHKYSUDãDQMLKVWDQGDUGL]DFLMHVSRGURþMDHOHNWURWHKQLNHLQHOHNWURQLNH9WDQDPHQSROHJGUXJLKDNWLYQRVWLL]GDMDWXGLPHGQDURGQHVWDQGDUGH,(&=DQMLKRYRSULSUDYRVRRGJRYRUQLWHKQLþQLRGERUL7&9VDNQDFLRQDOQLNRPLWH,(&NLJD]DQLPDREUDYQDYDQDWHPDODKNRVRGHOXMHYWHPSULSUDYOMDOQHPGHOX3UDYWDNRODKNRYSULSUDYLVRGHOXMHMRPHGQDURGQHRUJDQL]DFLMHWHUYODGQHLQQHYODGQHXVWDQRYHNLVRSRYH]DQH],(&,(&GHOXMHYWHVQLSRYH]DYL]PHGQDURGQRRUJDQL]DFLMR]DVWDQGDUGL]DFLMR,62VNODGQRVSRJRMLGRORþHQLPLYVRJODVMXPHGREHPDRUJDQL]DFLMDPD8UDGQHRGORþLWYHDOLVSRUD]XPL,(&RWHKQLþQLKYSUDãDQMLKSULSUDYOMHQLYWHKQLþQLKRGERULKNMHUVRSULVRWQLYVLQDFLRQDOQLNRPLWHMLNLMLKWHPD]DQLPDL]UDåDMRNROLNRUMHPRJRþHPHGQDURGQRVRJODVMHRREUDYQDYDQLWHPL,]GHODQLGRNXPHQWLLPDMRREOLNRSULSRURþLOLQVR]DPHGQDURGQRXSRUDERREMDYOMHQLYREOLNLVWDQGDUGRYWHKQLþQLKSRURþLODOLYRGLOLQMLKNRWWDNãQHVSUHMPHMRQDFLRQDOQLNRPLWHML'DELVHSRVSHãHYDORPHGQDURGQRSRHQRWHQMHVRQDFLRQDOQLNRPLWHML,(&YVYRMLKQDFLRQDOQLKLQUHJLRQDOQLKVWDQGDUGLKGROåQLþLPSUHJOHGQHMHXSRUDEOMDWLPHGQDURGQHVWDQGDUGH9VDNRRGVWRSDQMHPHGVWDQGDUGRP,(&LQXVWUH]QLPQDFLRQDOQLPDOLUHJLRQDOQLPVWDQGDUGRPMHWUHEDYVOHGQMHPMDVQRR]QDþLWL,(&QHSUHGSLVXMHQREHQHJDSRVWRSNDR]QDþHYDQMDNLELND]DOQDQMHJRYRSRWUGLWHYLQQHPRUHELWLRGJRYRUHQ]DNDWHURNROLRSUHPRNLELELODGHNODULUDQDNRWVNODGQD]HQLPRGQMHJRYLKVWDQGDUGRY2SR]RULWLMHWUHEDQDPRåQRVWGDVRODKNRQHNDWHULHOHPHQWLWHJDPHGQDURGQHJDVWDQGDUGDSUHGPHWSDWHQWQLKSUDYLF,(&QHSUHY]HPDRGJRYRUQRVWL]DSUHSR]QDYDQMHNDWHUHNROLDOLYHþWDNLKDYWRUVNLKSUDYLF*ODYQDQDORJDWHKQLþQLKRGERURY,(&MHSULSUDYDPHGQDURGQLKVWDQGDUGRY9L]MHPQLKRNROLãþLQDKODKNRWHKQLþQLRGERUSUHGODJDL]GDMRWHKQLþQHVSHFLILNDFLMHxWLSNDGDUNOMXEYHþNUDWQLPSRVNXVRPQLPRJRþHSULGRELWL]DKWHYDQHSRGSRUH]DL]GDMRPHGQDURGQHJDVWDQGDUGDxWLSNDGDUMHWHPDãHSUHGPHWWHKQLþQHJDUD]YRMDDOLMH]DUDGLGUXJLKUD]ORJRYYHUMHWQRGDERVRJODVMH]DPHGQDURGQLVWDQGDUGPRJRþHSULGRELWLYSULKRGQRVWLQHSDVHGDMxWLSNDGDUMHWHKQLþQLRGERU]EUDOUD]QHSRGDWNHRSRGURþMXGHODQDSULPHUªVWDQMHWHKQLNH©NLVRGUXJDþHODKNRL]GDQLWXGLNRWPHGQDURGQLVWDQGDUG7HKQLþQDSRURþLODWLSRYLQVHSUHJOHGXMHMRQDWULOHWDGDVHRGORþLDOLVHODKNRSUHREOLNXMHMRYPHGQDURGQLVWDQGDUG7HKQLþQLKSRURþLOWLSDQLWUHEDSUHJOHGRYDWLGRNOHUVHQHXJRWRYLGDVR]DMHWLSRGDWNLQHYHOMDYQLLQQHXSRUDEQL7DGUXJDL]GDMDUD]YHOMDYOMDLQQDGRPHãþDSUYRL]GDMRL]OHWDLQSUHGVWDYOMDQMHQRWHKQLþQRUHYL]LMR%HVHGLORWHJDWHKQLþQHJDSRURþLODWHPHOMLQDQDVOHGQMLKGRNXPHQWLK2VQXWHNWHKQLþQHJDRGERUD3RURþLORRJODVRYDQMX6HF59&RSROQDLQIRUPDFLMDRJODVRYDQMX]DSRWUGLWHYWHJDWHKQLþQHJDSRURþLODVHODKNRGRELL]SRURþLODRJODVRYDQMXQDYHGHQHPY]JRUQMLWDEHOL

6,67,(&75892'9VWDQGDUGLKLQSRURþLOLKQDSRGURþMXRSUHPHLQVLVWHPRYGDOMLQVNHJDYRGHQMDNLMLKMHWHKQLþQLRGERU,(&L]GHODOY]DGQMLKQHNDMOHWLKYREOLNLUD]OLþQLKGRNXPHQWRYVHULM,(&LQ,(&MHGRORþHQRãWHYLORL]UD]RYVSRVHEQLPSRPHQRP]DXSRUDERSULGDOMLQVNHPYRGHQMXNLãHQLVRRSUHGHOMHQLY,(&0HGQDURGQLHOHNWURWHKQLãNLVORYDU,(9±SRJODYMH'DOMLQVNRYRGHQMH6ORYDUMLYH]DQLQDSRVDPH]QHGRNXPHQWHL]VHULMHYHþLQRPDåHREVWDMDMR.OMXEWHPXMH]ELUNDXVWUH]QLKL]UD]RYYWHPGRNXPHQWXXSRUDEQD]DEUDOFD]JRUDMRPHQMHQLKGRNXPHQWRY9WHPRGGHONXVWDQGDUGD,(&VRSRDEHFHGQHPUHGXUD]YUãþHQLL]UD]LLQQMLKRYHGHILQLFLMH-HWXGLREVHåQRVUHGVWYR]DVNOLFHYDQMHQDL]UD]HSRVHEQHJDSRPHQDVSRGURþMDRSUHPHLQVLVWHPRYGDOMLQVNHJDYRGHQMDNLQDMELMLKSRQRYHPXSRUDEOMDOLYGRNXPHQWDFLMLQDSRGURþMXGDOMLQVNHJDYRGHQMD

6,67,(&752SUHPDLQVLVWHPLGDOMLQVNHJDYRGHQMD±GHO6SORãQR±RGGHOHN6ORYDU2EVHJLQSUHGPHWVWDQGDUGD2EUDYQDYDQRWHKQLþQRSRURþLORYHOMD]DRSUHPRLQVLVWHPHGDOMLQVNHJDYRGHQMD]ELWQRNRGLUDQLPVHULMVNLPSRGDWNRYQLPSUHQRVRP]DQDG]RULQYRGHQMH]HPOMHSLVQRUD]ãLUMHQLKSURFHVRY7DRGGHOHN,(&REVHJDWLVWHL]UD]HNLVHSRMDYOMDMRãHSRVHEHMSULWHKQLNDKGDOMLQVNHJDYRGHQMDWHUL]UD]HSRWUHEQH]DUD]XPHYDQMHVWDQGDUGRYQDSRGURþMXGDOMLQVNHJDYRGHQMD9SRURþLOXVRGDQHSRYH]DYH]GUXJLPLVORYDUMLVSRGURþMDHOHNWURWHKQLNHLQHOHNWURQLNHNMHUMHWRXSRUDEQR3RURþLORQHYVHEXMHL]UD]RY]DNDWHUHYHOMDPQHQMHGDMLKEUDOHFVWDQGDUGRYVSRGURþMDGDOMLQVNHJDYRGHQMDGREURSR]QD7RãHSRVHEHMYHOMD]DSRGURþMHNRPXQLNDFLMNMHUVRL]UD]LQSUªLQIRUPDFLMD©DOLªELW©YVDNGDQMLLQGREURUD]XPOMLYL=YH]D]GUXJLPLVWDQGDUGL6SRGDMQDYHGHQLVWDQGDUGLYVHEXMHMRGRORþLODNLVVNOLFHYDQMHPYWHPEHVHGLOXWYRULMRGRORþLODWXGL]DWDRGGHOHNVWDQGDUGRYVHULMH,(&2EL]GDMLVRELOLQDYHGHQLVWDQGDUGLYHOMDYQL9VLVWDQGDUGLVHSUHJOHGXMHMR]DWRQDMEUDOFLXSRUDEOMDMRQDMQRYHMãRL]GDMRVSRGDMQDYHGHQLKVWDQGDUGRYýODQL,(&LQ,62YRGLMRVH]QDPHWUHQXWQRYHOMDYQLKPHGQDURGQLKVWDQGDUGRY,(&,QWHUQDWLRQDO(OHFWURWHFKQLFDO9RFDEXODU\,(9±&KDSWHU'HSHQGDELOLW\DQGTXDOLW\RIVHUYLFH,(&,QWHUQDWLRQDO(OHFWURWHFKQLFDO9RFDEXODU\,(9±&KDSWHU$XWRPDWLFFRQWURO,(&,QWHUQDWLRQDO(OHFWURWHFKQLFDO9RFDEXODU\O(9±&KDSWHU7HOHFRQWURO,(&,QWHUQDWLRQDO(OHFWURWHFKQLFDO9RFDEXODU\,(9±&KDSWHU7HOHJUDSK\IDFVLPLOHDQGGDWDFRPPXQLFDWLRQ,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW*HQHUDOFRQVLGHUDWLRQV±6HFWLRQ%DVLFDVSHFWVRIWHOHFRQWUROGDWDWUDQVPLVVLRQDQGRUJDQL]DWLRQRIVWDQGDUGV,(&DQG,(&,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW2SHUDWLQJFRQGLWLRQV±6HFWLRQ3RZHUVXSSO\DQGHOHFWURPDJQHWLFFRPSDWLELOLW\,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7UDQVPLVVLRQSURWRFROV±6HFWLRQ*HQHUDOVWUXFWXUHRIDSSOLFDWLRQGDWD,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7UDQVPLVVLRQSURWRFROV±6HFWLRQ'HILQLWLRQDQGFRGLQJRIDSSOLFDWLRQLQIRUPDWLRQHOHPHQWV,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7UDQVPLVVLRQSURWRFROV±6HFWLRQ%DVLFDSSOLFDWLRQIXQFWLRQV,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7UDQVPLVVLRQSURWRFROV±6HFWLRQ&RPSDQLRQVWDQGDUGIRUEDVLFWHOHFRQWUROWDVNV,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7HOHFRQWUROSURWRFROVFRPSDWLEOHZLWK,62VWDQGDUGVDQG,787UHFRPPHQGDWLRQV±6HFWLRQ7$6(6HUYLFHGHILQLWLRQV

6,67,(&75,(&7HOHFRQWUROHTXLSPHQWDQGV\VWHPV±3DUW7HOHFRQWUROSURWRFROVFRPSDWLEOHZLWK,62VWDQGDUGVDQG,787UHFRPPHQGDWLRQV±6HFWLRQ7$6(3URWRFROGHILQLWLRQV,62,(&,QIRUPDWLRQWHFKQRORJ\±9RFDEXODU\±3DUW'DWDFRPPXQLFDWLRQ,62,(&,QIRUPDWLRQWHFKQRORJ\±7HOHFRPPXQLFDWLRQVDQGLQIRUPDWLRQH[FKDQJHEHWZHHQV\VWHPV±+LJKOHYH,GDWDOLQNFRQWURO+'/&SURFHGXUHV±)UDPHVWUXFWXUH,62,(&,QIRUPDWLRQWHFKQRORJ\±7HOHFRPPXQLFDWLRQVDQGLQIRUPDWLRQH[FKDQJHEHWZHHQV\VWHPV±+LJKOHYHOGDWDOLQNFRQWURO+'/&SURFHGXUHV±(OHPHQWVRISURFHGXUHV,62,QIRUPDWLRQWHFKQRORJ\±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±%DVLF5HIHUHQFH0RGHO7KH%DVLF0RGHO,62,QIRUPDWLRQSURFHVVLQJV\VWHPV±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±%DVLF5HIHUHQFH0RGHO±3DUW6HFXULW\$UFKLWHFWXUH,62,QIRUPDWLRQSURFHVVLQJV\VWHPV2SHQ6\VWHPV,QWHUFRQQHFWLRQ±%DVLFFRQQHFWLRQRULHQWHGVHVVLRQVHUYLFHGHILQLWLRQ,6275,QIRUPDWLRQSURFHVVLQJV\VWHPV±2SHQ6\VWHPV,QWHUFRQQHFWLRQ6HUYLFHFRQYHQWLRQV,62,QIRUPDWLRQSURFHVVLQJV\VWHPV±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±,QWHUQDORUJDQL]DWLRQRIWKH1HWZRUN/D\HU,62,(&,QIRUPDWLRQWHFKQRORJ\±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±6SHFLILFDWLRQRI$EVWUDFW6\QWD[1RWDWLRQ2QH$61,62,(&,QIRUPDWLRQWHFKQRORJ\±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±$SSOLFDWLRQ/D\HUVWUXFWXUH,62,(&,QIRUPDWLRQWHFKQRORJ\±2SHQ6\VWHPV,QWHUFRQQHFWLRQ±&RQIRUPDQFHWHVWLQJPHWKRGRORJ\DQGIUDPHZRUN±3DUW*HQHUDOFRQFHSWV,62,(&75,QIRUPDWLRQWHFKQRORJ\±)UDPHZRUNDQGWD[RQRP\RI,QWHUQDWLRQDO6WDQGDUL]HG3URIL,HV±3DUW*HQHUD,SULQFLSOHVDQGGRFXPHQWDWLRQ,62,(&75,QIRUPDWLRQWHFKQRORJ\±)UDPHZRUNDQGWD[RQRP\RI,QWHUQDWLRQDO6WDQGDUL]HG3URIL,HV±3DUW3ULQFLSOHVDQG7D[RQRP\IRU26,3URIL,HV,787;'HILQLWLRQRIWHUPVFRQFHUQLQJSXEOLFGDWDQHWZRUNV

6,67,(&75'HILQLFLMH,]UD]YVORYHQãþLQL,]UD]YDQJOHãþLQL'HILQLFLMDYVORYHQãþLQL±DEVROXWQDNURQRORJLMD±DEVROXWHFKURQRORJ\WLPHWDJJLQJ3UHQRVLQIRUPDFLMHRVSUHPHPELVWDQMDSULNDWHUHPVHSUHQHVHQLLQIRUPDFLMLGRGDSRGDWHNRWRþQHPþDVXQDVWDQNDVSUHPHPEHYPHMDKþDVRYQHUD]ORþOMLYRVWL>,(9@±SRWUGLWHY±DFNQRZOHGJHPHQW*OHMSR]LWLYQRDOLQHJDWLYQRSRWUGLWHY±þDV]DMHPD±DFTXLVLWLRQWLPH1DMNUDMãLþDVSRWUHEHQ]DSUDYLOQRRGNULWMHLQREGHODYRVSUHPHPEHVWDQMD±QDVORY±DGGUHVV'HOVSRURþLODNLRGNULMHQMHJRYL]YRUDOLFLOM±QDVWDYLWYHQLXND]±DGMXVWLQJFRPPDQG8ND]NLSRY]URþLVSUHPHPERYHþSRORåDMQLKHOHPHQWRYHOHNWURHQHUJHWVNHJDVLVWHPD>,(9@±DODUP±DODUP,QIRUPDFLMDNLRSR]DUMDQDQHQRUPDOQRVWDQMH0213054768/91;:<=>@?BACED>':F7G'HD :FNG'HD>POQG'DRTJAULJA?D>E>CJA:>KF7GCL>JV@D>W>KS@>C>':AH>X;YA'IKGZR<[Q:<'\@GWS@>Q:?AQA];1;:<=>@?^ACWD ':F7G'HD ':F7G'HD>ZOQG'DR<`S@>'DGLG@?A'S@>LCJ:>KV@AJO@SK:[SK:AYGCGX'LaD <'YGQ<:A=SK:AFN<:A=BS@GbQc ?AdLJA?D>e>CJA:>JF7GbCL>JV@D>e>KS@>C>':AH>XfYAgIKGPRQ:?AQA]±DQDORJQLVLJQDO±DQDORJXHVLJQDO6LJQDOYREOLNL]YH]QRVSUHPHQOMLYHYUHGQRVWL±DSOLNDFLMVND]GUXåLWHY±DSSOLFDWLRQDVVRFLDWLRQ6RGHORYDQMHGYHKSR]LYQLKDSOLNDFLMVNRVWRULWYHQLKREMHNWRYNLRPRJRþDRERMHVWUDQVNRXSRUDERSUHGVWDYLWYHQHVWRULWYH]DL]PHQMDYRSRGDWNRYLQNRRUGLQDFLMRQMXQHJDVNXSQHJDGHORYDQMD>,62,(&@±DSOLNDFLMVNDHQWLWHWD±DSSOLFDWLRQHQWLW\$(9LGLNLDSOLNDFLMVNHJDSURFHVDY]YH]L]PHGVHERMQLPSRYH]RYDQMHPRGSUWLKVLVWHPRY26,>,62@±DSOLNDFLMVNHIXQNFLMH±DSSOLFDWLRQIXQFWLRQV)XQNFLMHSURFHVDSRWUHEQH]DQMHJRYRXSRUDERYVLVWHPXGDOMLQVNHJDYRGHQMDDOLVLVWHPX6&$'$SOLNDFLMVNHIXQNFLMHVHGHOLMRQDRVQRYQHLQUD]ãLUMHQHSURFHVQHIXQNFLMH±DSOLNDFLMVNHIXQNFLMHSULRVQRYQHPUHIHUHQþQHPPRGHOX±DSSOLFDWLRQIXQFWLRQVLQWKHVHQVHRIWKHEDVLFUHIHUHQFHPRGHO'HODSOLNDFLMVNLKSURFHVRYNLL]YDMDGDOMLQVNRNRPXQLNDFLMRPHGDSOLNDFLMVNLPLSURFHVL>,62@±DSOLNDFLMVNLSURFHV±DSSOLFDWLRQSURFHVV(OHPHQWYUHDOQHPRGSUWHPVLVWHPXNLREGHOXMHLQIRUPDFLMH]DGRORþHQRDSOLNDFLMR>,62@±DSOLNDFLMVNLSURILO±DSSOLFDWLRQSURILOH3URILONLGRORþDXSRUDERSURWRNROQLKVWDQGDUGRYSRYH]RYDQMDRGSUWLKVLVWHPRY26,SODVWLRGGRNL]DJRWDYOMDMRVWUXNWXULUDQSUHQRVLQIRUPDFLMPHGVLVWHPL

6,67,(&75,]UD]YVORYHQãþLQL,]UD]YDQJOHãþLQL'HILQLFLMDYVORYHQãþLQL±DSOLNDFLMVNLVWRULWYHQLHOHPHQW±DSSOLFDWLRQVHUYLFHHOHPHQW'HODSOLNDFLMVNHHQWLWHWHNL]DJRWDYOMDGHORYDQMHSRYH]RYDQMDRGSUWLKVLVWHPRY26,LQSRSRWUHELXSRUDEOMDVWRULWYHQLåMLKSODVWL>,62@±VWRULWYHQLHOHPHQW]DNUPLOMHQMH]GUXåLWYH±DVVRFLDWLRQFRQWUROVHUYLFHHOHPHQW$SOLNDFLMVNLVWRULWYHQLHOHPHQWNL]DJRWDYOMDSRVHEQDVUHGVWYD]DY]SRVWDYLWHYLQSUHNLQLWHYYVHKDSOLNDFLMVNLK]GUXåLWHY>,62,(&@±DVLQKURQLSUHQRVSULGDOMLQVNHPYRGHQMX±DV\QFKURQRXVWHOHFRQWUROWUDQVPLVVLRQ*OHMVWDUWVWRSSUHQRVSULGDOMLQVNHPYRGHQMX±DVLQKURQLSUHQRV±DV\QFKURQRXVWUDQVPLVVLRQ3RGDWNRYQLSUHQRVVSROMXEQLPþDVRPQDVWRSDSRVDPH]QHJD]QDNDDOL]QDNRYQHJDEORNDNRVHSUHQRV]DþQHMHQDVWRSYVDNHJDVLJQDODNLSUHGVWDYOMDQHNELW]QRWUDM]QDNDDOL]QDNRYQHJDEORNDþDVRYQRXVNODMHQ>,62@±DYWRPDWVNRYRGHQMHSURL]YRGQMH±DXWRPDWLFJHQHUDWLRQFRQWURO$*&*OHMUHJXODFLMRIUHNYHQFHLQPRþL±SRPRåQDLQIRUPDFLMD±DX[LOLDU\LQIRUPDWLRQ,QIRUPDFLMDNLVHXSRUDEOMD]DXSUDYOMDQMHREUDWRYDQMDVLVWHPDGDOMLQVNHJDYRGHQMD±UD]SRORåOMLYRVW±DYDLODELOLW\=PRåQRVWQDSUDYHDOLVLVWHPDGDYSROMXEQHPWUHQXWNXRSUDYOMDVYRMR]DKWHYDQRIXQNFLMR±SRYSUHþQLSUHQRVQLþDV±DYHUDJHWUDQVIHUWLPH3RYSUHþHQþDVSRWUHEHQ]DSUHQRVSROMXEQHSRMDYLWYHSUYRWQHJDVLJQDODJOHGHQDVLVWHPGDOMLQVNHJDYRGHQMD>,(9@±VLPHWULþQLWRNRNURJVLPHWULþQLYRGVLPHWULþQLVLJQDOQLSDU±EDODQFHGFLUFXLWEDODQFHGOLQHEDODQFHGVLJQDOSDLU3UHQRVQLYRGVHVWDYOMHQL]GYHKYRGQLNRYRESULVRWQRVWL]HPOMHVSRVREHQREUDWRYDWLWDNRGDVWDWRNRYDYYRGQLNLKYSULPHUXNRVWDQMXQLDPSOLWXGLQDSHWRVWLHQDNLQDYVHKSUHþQLKUDYQLQDKLQQDVSURWQLSRSRODULWHWLJOHGHQD]HPOMRHQDNDSRYHOLNRVWLLQQDVSURWQDSRVPHUL±XUDYQRWHåHQLSUHQRV±EDODQFHGWUDQVPLVVLRQ3UHQRVQDPHWRGDSULNDWHULODKNRHQDDOLGUXJDSRGDWNRYQDWHUPLQDOVNDRSUHPD'7(GYHKPHGVHERMQRSRYH]DQLKSRVWDMVSURåLSUHQRVVSRURþLODYSROMXEQHPWUHQXWNX>,(&@±]DSRUQDQDSUDYD±EDUULHUGHYLFH1DSUDYDNLRPRJRþDJDOYDQVNRORþLWHYRSUHPHGDOMLQVNHJDYRGHQMDRGREUDWRYDOQHRSUHPHQSUUHOHRSWLþQLVSRMQLNDOLWUDQVIRUPDWRU±RVQRYQLVWDQGDUG±EDVHVWDQGDUG2GREUHQPHGQDURGQLVWDQGDUGWHKQLþQRSRURþLORDOLSULSRURþLOR,787NLVHXSRUDEOMDYGHILQLFLMLSURILOD>,62,(&75@±RVQRYQDDSOLNDFLMVNDIXQNFLMDYGDOMLQVNHPYRGHQMX±EDVLFDSSOLFDWLRQIXQFWLRQLQWHOHFRQWURO3RVWRSHNSUHQRVDVNDWHULPVHL]YDMDQDG]RUQDIXQNFLMDDOLIXQNFLMDYRGHQMDLQVHYVLVWHPLKGDOMLQVNHJDYRGHQMDSRJRVWRXSRUDEOMD>,(&@1;i)j47k;i)j91l:<'D >O2cYG C G'X SJ:<'D >Od?J>IK>?KYG'XmAYHAVD@ASJ:<'D >O2AQ?]

6,67,(&75,]UD]YVORYHQãþLQL,]UD]YDQJOHãþLQL'HILQLFLMDYVORYHQãþLQL±RVQRYQHIXQNFLMH±EDVLFIXQFWLRQV)XQNFLMHNLLPDMRRSUDYND]YVHPLYUVWDPLLQIRUPDFLMPHGREUDWRYDOQRRSUHPRLQRSHUDWHUMHP±RVQRYQLUHIHUHQþQLPRGHOSRYH]RYDQMHRGSUWLKVLVWHPRY±EDVLFUHIHUHQFHPRGHO1DPHQPHGQDURGQHJDVWDQGDUGQHJDUHIHUHQþQHJDPRGHODSRYH]RYDQMDRGSUWLKVLVWHPRYMH]DJRWRYLWLVNXSQRRVQRYR]DNRRUGLQDFLMRUD]YRMDVWDQGDUGRYQDSRGURþMXSRYH]RYDQMDVLVWHPRYLQKNUDWLRPRJRþLWLSULND]REVWRMHþLKVWDQGDUGRY]YLGLNDVSORãQHJDUHIHUHQþQHJDPRGHOD,]UD]SRYH]RYDQMHRGSUWLKVLVWHPRY26,R]QDþXMHVWDQGDUGH]DL]PHQMDYRLQIRUPDFLMPHGVLVWHPLNLVRGUXJGUXJHPXQDPHQRPDªRGSUWL©]DUDGLY]DMHPQHUDEHXSRUDEQLKVWDQGDUGRY'HMVWYRGDMHVLVWHPRGSUWQHSRPHQLQREHQHSRVHEQHXSRUDEHVLVWHPRYWHKQRORJLMHDOLVUHGVWHYSRYH]RYDQMDDPSDNVHQDQDãDQDPHGVHERMQRSUL]QDYDQMHLQSRGSRURXSRUDEQLKVWDQGDUGRY±EDXG±EDXG%G(QRWDPRGXODFLMVNHKLWURVWLDOLHQRWDSUHQRVQHKLWUR
...