CEN/TS 13244-7:2003
(Main)Plastics piping systems for buried and above-ground pressure systems for water for general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the assessment of conformity
Plastics piping systems for buried and above-ground pressure systems for water for general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the assessment of conformity
This Part of EN 13244 specifies procedures and requirements for the assessment of conformity to be included in the manufacturer's quality plan as part of his quality system for third party certification of conformity by a certification body accredited to EN 45011 or EN 45012, as appplicable and includes: a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244; b) requirements for the manufacturer's quality system given in EN ISO 9001 or EN ISO 9002, as applicable.
Kunststoff-Rohrleitungssysteme für erd- und oberirdisch verlegte Druckrohrleitungen für Brauchwasser, Entwässerung und Abwasser - Polyethylen (PE) - Teil 7: Empfehlungen für die Beurteilung der Konformität
PrCEN/TS 13244-7 gibt Empfehlungen für die Beurteilung der Konformität, die als Teil des Qualitätssicherungssystems im Qualitätssicherungsplan des Herstellers enthalten sein müssen.
Diese Technische Spezifikation enthält:
a) Anforderungen an Werkstoffe, Rohrleitungsteile sowie Verbindungen und Bauteilkombinationen, die in den Teilen 1 bis 5 der prEN 13244 festgelegt sind;
b) Anforderungen an das Qualitätssicherungssystem des Herstellers;
ANMERKUNG 1 : Es wird empfohlen, dass das Qualitätssicherungssystem EN ISO 9001[1] entspricht.
c) Definitionen und Verfahren im Falle der Zertifizierung durch unparteiische Dritte.
ANMERKUNG 2 Es wird empfohlen, die Zertifizierung durch eine unabhängige Zertifizierungsstelle durchführen zu lassen, die in Abhängigkeit der Anwendung nach EN 45011[2] oder EN 45012[3] zugelassen ist.
Zusammen mit den übrigen Teilen der prEN 13244 (siehe Vorwort) gilt dieser Teil für Rohrleitungssysteme aus Polyethylen (PE), die für die erd- und unterirdische Verlegung von Druckrohrleitungen für Brauchwasser, Entwässerung und Abwasser vorgesehen sind.
Systèmes de canalisations en plastiques pour les applications générales de transport d'eau, de branchement et de collecteurs d'assainissement, enterrés sous pression - Polyéthylène (PE) - Partie 7: Guide pour l'évaluation de la conformité
La présente Partie de l'EN 13244 donne un guide pour l'évaluation de la conformité à inclure dans le plan qualité du fabricant, en tant que partie de son système qualité.
La présente Spécification technique comprend :
a) les exigences pour les matières, les composants et les assemblages, données dans les Parties 1 à 5 de l'EN 13244 ;
b) les exigences pour le système qualité du fabricant ;
NOTE 1 Il est recommandé que le système qualité réponde à l'EN ISO 9001[1].
c) les définitions et les procédures à appliquer si une certification par tierce partie est prise en compte.
NOTE 2 Si une certification par tierce partie est prise en compte, il est recommandé que l'organisme de certification soit accrédité au sens de l'EN 45011[2] ou de l'EN 45012[3] selon le cas.
Conjointement avec les autres Parties de l'EN 13244 (voir l'avant-propos), elle s'applique aux systèmes de canalisations en polyéthylène (PE) destinés à être utilisés dans des applications générales de transport d'eau, de branchement et de collecteurs d'assainissement, enterrés et aériens sous pression.
Cevni sistemi iz polimernih materialov, podzemni in nadzemni, za tlačne vodovode splošne namembnosti, odvodnjavanje in kanalizacijo – Polietilen (PE) - 7. del: Navodilo za ugotavljanje skladnosti
General Information
Relations
Buy Standard
Standards Content (Sample)
SLOVENSKI STANDARD
01-maj-2004
&HYQLVLVWHPLL]SROLPHUQLKPDWHULDORYSRG]HPQLLQQDG]HPQL]DWODþQHYRGRYRGH
VSORãQHQDPHPEQRVWLRGYRGQMDYDQMHLQNDQDOL]DFLMR±3ROLHWLOHQ 3( GHO
1DYRGLOR]DXJRWDYOMDQMHVNODGQRVWL
Plastics piping systems for buried and above-ground pressure systems for water for
general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the
assessment of conformity
Kunststoff-Rohrleitungssysteme für erd- und oberirdisch verlegte Druckrohrleitungen für
Brauchwasser, Entwässerung und Abwasser - Polyethylen (PE) - Teil 7: Empfehlungen
für die Beurteilung der Konformität
Systemes de canalisations en plastiques pour les applications générales de transport
d'eau, de branchement et de collecteurs d'assainissement, enterrés sous pression -
Polyéthylene (PE) - Partie 7: Guide pour l'évaluation de la conformité
Ta slovenski standard je istoveten z: CEN/TS 13244-7:2003
ICS:
23.040.01 Deli cevovodov in cevovodi Pipeline components and
na splošno pipelines in general
93.030 Zunanji sistemi za odpadno External sewage systems
vodo
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
TECHNICAL SPECIFICATION
CEN/TS 13244-7
SPÉCIFICATION TECHNIQUE
TECHNISCHE SPEZIFIKATION
August 2003
ICS 93.030
English version
Plastics piping systems for buried and above-ground pressure
systems for water for general purposes, drainage and
sewerage — Polyethylene (PE) — Part 7: Guidance for the
assessment of conformity
Systèmes de canalisations en plastique pour les Kunststoff-Rohrleitungssysteme für erd- und oberirdisch
applications générales de transport d'eau, de branchement verlegte Druckrohrleitungen für Brauchwasser,
et de collecteurs d'assainissement, enterrés sous Entwässerung und Abwasser — Polyethylen (PE) — Teil 7:
pression — Polyéthylène (PE) — Partie 7: Guide pour Empfehlungen für die Beurteilung der Konformität
l'évaluation de la conformité
This Technical Specification (CEN/TS) was approved by CEN on 9 October 2002 for provisional application.
The period of validity of this CEN/TS is limited initially to three years. After two years the members of CEN will be requested to submit their
comments, particularly on the question whether the CEN/TS can be converted into a European Standard.
CEN members are required to announce the existence of this CEN/TS in the same way as for an EN and to make the CEN/TS available. It
is permissible to keep conflicting national standards in force (in parallel to the CEN/TS) until the final decision about the possible
conversion of the CEN/TS into an EN is reached.
CEN members are the national standards bodies of Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece,
Hungary, Iceland, Ireland, Italy, Luxembourg, Malta, Netherlands, Norway, Portugal, Slovakia, Spain, Sweden, Switzerland and United
Kingdom.
EUROPEAN COMMITTEE FOR STANDARDIZATION
COMITÉ EUROPÉEN DE NORMALISATION
EUROPÄISCHES KOMITEE FÜR NORMUNG
Management Centre: rue de Stassart, 36 B-1050 Brussels
© 2003 CEN All rights of exploitation in any form and by any means reserved Ref. No. CEN/TS 13244-7:2003 E
worldwide for CEN national Members.
Contents
Foreword .3
Introduction .4
1 Scope.5
2 Normative references.5
3 Terms, definitions, symbols and abbreviations.6
3.1 Terms and definitions .6
3.2 Abbreviations.8
4 Requirements.9
4.1 General .9
4.2 Testing and inspection .9
Annex A (normative) Change of PE compound .23
Annex B (normative) Change of design .25
Bibliography .26
Foreword
This document CEN/TS 13244-7:2003 has been prepared by Technical Committee CEN /TC 155,
"Plastics piping systems and ducting systems", the secretariat of which is held by NEN.
This Technical Specification can be used to support the elaboration of national third party certification
procedures for products conforming to the applicable Parts of EN 13244.
This Technical Specification is a Part of a System Standard for plastics piping systems of a particular
material for a specified application. There are a number of such System Standards.
System Standards are based on the results of the work being undertaken in ISO/TC 138 "Plastics
pipes, fittings and valves for the transport of fluids", which is a Technical Committee of the
International Organization for Standardization (ISO).
They are supported by separate standards on test methods to which references are made throughout
the System Standard.
The System Standards are consistent with standards on general functional requirements and
standards on recommended practice for installation.
EN 13244 consists of the following Parts, under the general title "Plastics piping systems for buried
and above-ground pressure systems for water for general purposes, drainage and sewerage —
Polyethylene (PE)".
Part 1: General
Part 2: Pipes
Part 3: Fittings
Part 4: Valves
Part 5: Fitness for purpose of the system
Part 7: Guidance for the assessment of conformity (this technical specification)
NOTE It was decided not to publish a Part 6: Recommended practice for installation. Instead, existing national installation
practices would be applicable.
This Technical Specification includes the following annexes.
Annex A (Normative) Change of PE compound.
Annex B (Normative) Change of design.
Bibliography.
System Standards for piping systems of other plastics materials used for the conveyance of water,
drainage and sewerage under pressure include the following:
EN 1456, Plastics piping systems for buried and above- ground drainage and sewerage under
pressure – Unplasticized poly(vinyl chloride) (PVC-U)
prEN 14364, Plastics piping systems for pressure and non-pressure drainage and sewerage — Glass-
reinforced thermosetting (GRP) plastics based on polyester resin (UP)
According to the CEN/CENELEC Internal Regulations, the national standards organizations of the
following countries are bound to announce this CEN Technical Specification : Austria, Belgium, Czech
Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxembourg,
Malta, Netherlands, Norway, Portugal, Slovakia, Spain, Sweden, Switzerland and the United
Kingdom.
Introduction
The System Standard, of which this is Part 7, specifies the requirements for a piping system and its
components made from polyethylene (PE). It is intended to be used for buried and above-ground
pressure systems for water for general purposes, drainage and sewerage.
This Part of EN 13244 gives guidance for the procedures and requirements for the assessment of
conformity of materials, components, joints and assemblies and is intended to be used by certification
bodies, inspection bodies, testing laboratories and manufacturers.
1 Scope
This Part of EN 13244 gives guidance for the assessment of conformity to be included in the
manufacturer’s quality plan as part of his quality system.
This Technical Specification includes:
a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244;
b) requirements for the manufacturer's quality system;
[1]
NOTE 1 It is recommended that the quality system conforms to EN ISO 9001
c) definitions and procedures to be applied if third party certification is involved.
[2]
NOTE 2 If third party certification is involved, it is recommended that the certification body is accredited to EN 45011 or
[3]
EN 45012 , as applicable.
In conjunction with one or more Parts of EN 13244 (see Foreword) it is applicable to polyethylene
(PE) piping systems intended to be used for buried and above-ground pressure systems for water for
general purposes, drainage and sewerage.
2 Normative references
This Technical Specification incorporates by dated or undated reference, provisions from other
publications. These normative references are cited at the appropriate places in the text, and the
publications are listed hereafter. For dated references, subsequent amendments to or revisions of any
of these publications apply to this Technical Specification only when incorporated in it by amendment
or revision. For undated references the latest edition of the publication referred to applies (including
amendments).
EN 13244-1:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 1: General.
EN 13244-2:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 2: Pipes.
EN 13244-3:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 3: Fittings.
EN 13244-4:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 4: Valves.
EN 13244-5:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 5: Fitness for purpose of
the system.
EN ISO 6259-1:2001, Thermoplastics pipes — Determination of tensile properties – Part 1: General
test method (ISO 6259-1:1997).
EN ISO 12162:1995, Thermoplastics materials for pipes and fittings for pressure applications —
Classification and designation — Overall service (design) coefficient (ISO 12162:1995).
ISO 2859-1:1999, Sampling procedures for inspection by attributes — Part 1: Sampling schemes
indexed by acceptance quality limit (AQL) for lot-by-lot inspection.
ISO 3951:1989, Sampling procedures and charts for inspection by variables for percent
nonconforming.
ISO 6259-3:1997, Thermoplastics pipes — Determination of tensile properties — Part 3: Polyolefin
pipes.
ISO 13954:1997, Plastics pipes and fittings — Peel decohesion test for polyethylene (PE)
electrofusion assemblies of nominal outside diameter greater than or equal to 90 mm.
ISO 13955:1997, Plastics pipes and fittings — Crushing decohesion test for polyethylene (PE)
electrofusion assemblies.
ISO/DIS 13956:1996, Plastics pipes and fittings — Determination of cohesive strength — Tear test
for polyethylene (PE) assemblies.
3 Terms, definitions, symbols and abbreviations
For the purposes of this Technical Specification the terms, definitions, symbols and abbreviations
given in Part 1 and Part 3 to Part 5 of EN 13244, apply together with the following.
3.1 Terms and definitions
3.1.1
certification body
impartial body, governmental or non-governmental, possessing the necessary competence and
responsibility to carry out certification of conformity according to given rules of procedure and
management
3.1.2
inspection body
impartial organisation or company, approved by a certification body as possessing the necessary
competence to verify and/or to carry out initial type testing, witness testing, audit testing and
inspection of the manufacturer's factory production control in accordance with the relevant European
Standard
3.1.3
testing laboratory
laboratory which measures, tests, calibrates or otherwise determines the characteristics of the
performance of materials and products
3.1.4
quality management system
organisational structure, responsibilities, procedures, processes and resources for implementing
[4]
quality management (see EN ISO 9000 )
3.1.5
quality management plan
document setting out the specific quality practices, resources and sequence of activities relevant to a
particular product or range of products
3.1.6
type testing (TT)
tests performed to prove that the material, component, joint or assembly is capable of conforming to
the requirements given in the relevant standard
3.1.7
preliminary type testing (PTT)
type testing carried out by, or on behalf of, the manufacturer
3.1.8
initial type testing (ITT)
type testing carried out by, or on behalf of, a certification body for certification purposes
3.1.9
batch release test (BRT)
test performed by the manufacturer on a batch of components, which has to be satisfactorily
completed before that batch can be released
3.1.10
process verification test (PVT)
test performed by the manufacturer on materials, components, joints or assemblies at specific
intervals to confirm that the process continues to be capable of producing components conforming to
the requirements given in the relevant standard
NOTE Such tests are not required to release batches of components and are carried out as a measure of process control.
3.1.11
audit test (AT)
test performed by, or on
...
Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.